SecReT4
Protein ID: 38201720
T4SS name [ID]Tra_I [178]
Gene symboltraM
Locus tagST42906_p052
StrainSerratia entomophila plasmid pADAP (NC_002523)
Repliconplasmid pADAP [GenBank: NC_002523] [Browse all T4SS(s) in this replicon]
Location [Strand]691..1365 [-]
ProductTraM
Component typeTraM_I
UniProt IDQ7BQX7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 1.9e-36, Aligned region: 74..180
Protein Sequence: 224 a.a.     [Download]
>gi|38201720|ref|NP_938087.1| TraM [Serratia entomophila]
MQKKQPVTPSSELPGPYDAAIAQHQANQLNVSLTRKSLTTNVWQSATITLCLLIIGVLIYAVLHPPVKYF
ATQDGRVIPLTPTDQPAYSDADVTDFGNRVIREAFTLDFVNYRTQMNNLLPRFSDEGFRSYYTALTTSNV
LAAVKDKKMNMSVMTSPGVIVSKGTLENGVYAWKIQYPTKFKMTGQTSSLPEQSFVVSLLIQRTDPRLKN
TGMEVSQLITYEAQ
 
Nucleotide Sequence: 675 bp     [Download]
>gi|162957997|ref|NC_002523.4|:c1365-691 Serratia entomophila plasmid pADAP, complete sequence
ATGCAAAAAAAACAGCCTGTCACTCCTTCATCGGAGTTACCTGGTCCCTATGACGCCGCCATCGCGCAGC
ATCAGGCCAACCAACTGAATGTTAGTTTGACCCGCAAGTCATTGACCACCAACGTGTGGCAAAGCGCCAC
TATCACCCTCTGCTTGTTGATCATTGGTGTGTTGATCTACGCCGTGTTGCACCCGCCGGTGAAGTATTTT
GCCACGCAGGATGGTCGGGTCATTCCCCTCACGCCAACGGACCAGCCAGCGTACAGCGATGCCGATGTGA
CCGACTTTGGTAACCGCGTGATACGTGAAGCTTTCACCCTCGACTTTGTGAATTACCGCACGCAGATGAA
TAACTTGCTTCCTCGTTTTTCCGATGAGGGATTTCGCAGTTACTACACCGCGTTGACCACGTCCAACGTT
CTCGCCGCGGTTAAGGACAAGAAAATGAATATGTCCGTCATGACCTCGCCGGGCGTCATCGTCAGTAAAG
GGACGCTGGAGAACGGTGTTTATGCCTGGAAAATCCAGTACCCCACCAAATTCAAGATGACAGGCCAAAC
GTCGTCACTGCCCGAACAAAGTTTTGTTGTGTCGCTGCTGATTCAACGTACCGATCCCCGGTTGAAAAAC
ACCGGCATGGAAGTGTCCCAGCTCATTACTTATGAGGCTCAATAG
 Primer design