SecReT4
Protein ID: 38201721
T4SS name [ID]Tra_I [178]
Gene symboltraL
Locus tagST42906_p051
StrainSerratia entomophila plasmid pADAP (NC_002523)
Repliconplasmid pADAP [GenBank: NC_002523] [Browse all T4SS(s) in this replicon]
Location [Strand]1456..1947 [-]
ProductTraL
Component typeTraL_I
UniProt IDQ7BQX6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 163 a.a.     [Download]
>gi|38201721|ref|NP_938088.1| TraL [Serratia entomophila]
MQLRSIFLATLVAGAMTLPAHAASCRAASAAQVGAQNGYERDRKAAEAWSQRENQVSSGLQQCLGDISTA
ITVPTFPDLSGILNGIKDKICRAAHDKIQEYIPSQIDPWGDLSSRSGGLAGTSSRSVNVPKNYAPTTYQQ
APVVSSPTPQSSGSTGGDYLFSR
 
Nucleotide Sequence: 492 bp     [Download]
>gi|162957997|ref|NC_002523.4|:c1947-1456 Serratia entomophila plasmid pADAP, complete sequence
ATGCAATTGCGCTCTATTTTCCTGGCCACGTTAGTGGCAGGTGCCATGACGTTGCCTGCACATGCCGCCA
GCTGTCGAGCCGCCTCAGCGGCACAAGTCGGCGCCCAAAACGGCTATGAGCGGGACCGTAAAGCAGCAGA
AGCTTGGTCTCAACGTGAAAATCAGGTATCCAGTGGATTGCAGCAATGCTTGGGGGATATCAGTACGGCG
ATCACCGTGCCAACCTTTCCAGATCTGAGCGGTATTCTCAACGGAATAAAAGACAAGATTTGCCGCGCCG
CACACGACAAGATCCAAGAGTACATTCCTAGTCAAATCGACCCCTGGGGGGACTTATCTTCTCGCAGTGG
TGGCCTGGCAGGTACATCTTCACGTTCAGTCAATGTGCCTAAGAACTACGCCCCAACCACTTACCAACAG
GCGCCCGTTGTATCTTCACCGACACCGCAATCCTCGGGTTCGACCGGCGGTGATTACCTCTTCAGTCGTT
AA
 Primer design