SecReT4
Protein ID: 38257075
T4SS name [ID]VirB [432]
Gene symbolvirB7
Locus tagpPSR1_p44
StrainPseudomonas syringae pv. syringae plasmid pPSR1 (NC_005205)
Repliconplasmid pPSR1 [GenBank: NC_005205] [Browse all T4SS(s) in this replicon]
Location [Strand]53706..54008 [+]
ProductVirB7
Component typeVirB7
UniProt IDQ6VE83
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 100 a.a.     [Download]
>gi|38257075|ref|NP_940729.1| VirB7 [Pseudomonas syringae pv. syringae]
MNFKLALSGLLSAALLSGCGSAPKLSEPEGQWEDMPFTHAPAPRAAPAATPAPAPGRVLPAASPAPKAQS
LKTTPSKRPASASPAKPAEAPPNDSKCSAN
 
Nucleotide Sequence: 303 bp     [Download]
>gi|38257032|ref|NC_005205.1|:53706-54008 Pseudomonas syringae pv. syringae A2 plasmid pPSR1, complete sequence
ATGAATTTCAAACTTGCTTTGAGCGGGCTGCTTTCGGCTGCCTTGCTTTCAGGGTGTGGCTCTGCACCCA
AACTGTCCGAACCGGAAGGGCAATGGGAAGACATGCCCTTCACCCATGCCCCTGCGCCTCGCGCTGCTCC
CGCGGCAACGCCTGCTCCCGCGCCTGGCCGGGTGCTGCCAGCAGCGAGCCCTGCGCCCAAGGCCCAGTCG
CTCAAGACCACCCCTTCAAAGCGTCCGGCAAGCGCGTCCCCGGCAAAGCCTGCCGAGGCCCCGCCCAACG
ATTCCAAATGCTCCGCGAACTGA
 Primer design