SecReT4
Protein ID: 38257076
T4SS name [ID]VirB [432]
Gene symbolvirB8
Locus tagpPSR1_p45
StrainPseudomonas syringae pv. syringae plasmid pPSR1 (NC_005205)
Repliconplasmid pPSR1 [GenBank: NC_005205] [Browse all T4SS(s) in this replicon]
Location [Strand]54046..54834 [+]
ProductVirB8
Component typeVirB8
UniProt IDQ6VE82
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 7.6e-50, Aligned region: 42..255
Protein Sequence: 262 a.a.     [Download]
>gi|38257076|ref|NP_940730.1| VirB8 [Pseudomonas syringae pv. syringae]
MKKLRKSKQDVIDQERQLAARTSIDAATAQEISLAEQAFTHAARFFEKNIAAEEKAKTKNARRLAGFFGV
LTFMSIAAVLGLTPLKTVQLGLVRVDNNSGYTDVVWANDKGKPQEQIDDEFWLSAYARFRESYNFSSNDA
NYSMVKLMSYDETFTEYRNFQLSSKGYLEVLGTNRQIRTDINNINFLERKDRAGTAQVRITKTVLDRNGT
PDPQLAPVTWVATVTYDYNNPAKKAGDQWLNPRGFGVRAYTMTQEVGVSNGK
 
Nucleotide Sequence: 789 bp     [Download]
>gi|38257032|ref|NC_005205.1|:54046-54834 Pseudomonas syringae pv. syringae A2 plasmid pPSR1, complete sequence
ATGAAAAAGCTACGAAAATCCAAACAGGACGTGATTGACCAGGAGCGCCAACTGGCCGCCCGTACCAGCA
TCGATGCGGCCACCGCACAAGAAATCAGCCTGGCTGAGCAGGCCTTTACCCACGCAGCGCGGTTTTTCGA
GAAGAACATCGCCGCCGAAGAGAAGGCCAAGACCAAAAACGCCCGTCGCCTGGCGGGCTTCTTCGGTGTG
CTGACCTTTATGTCGATCGCCGCTGTGCTGGGCCTGACCCCGCTCAAGACCGTGCAGCTCGGGCTGGTGC
GGGTCGATAACAACTCCGGCTACACGGACGTCGTGTGGGCCAACGACAAAGGCAAGCCACAGGAGCAGAT
CGATGACGAGTTCTGGCTTTCTGCCTATGCGCGCTTTCGCGAGAGCTACAACTTTTCGAGTAACGATGCC
AATTACAGCATGGTCAAGTTGATGTCTTATGACGAGACGTTTACCGAGTACCGCAACTTCCAATTGTCCT
CTAAAGGCTATCTGGAAGTGCTGGGGACCAACCGGCAGATTCGTACTGACATCAACAATATCAATTTCCT
TGAGCGTAAAGACCGGGCAGGCACCGCCCAGGTGCGGATCACCAAAACCGTGCTGGATCGCAACGGCACC
CCCGATCCCCAGCTGGCCCCTGTGACGTGGGTTGCGACAGTGACTTACGACTACAACAATCCGGCCAAAA
AAGCCGGTGACCAGTGGCTTAACCCCCGTGGCTTCGGGGTCAGGGCCTATACGATGACCCAGGAAGTGGG
GGTGTCCAATGGGAAATAA
 Primer design