SecReT4
Protein ID: 38257079
T4SS name [ID]VirB [432]
Gene symbolvirB11
Locus tagpPSR1_p48
StrainPseudomonas syringae pv. syringae plasmid pPSR1 (NC_005205)
Repliconplasmid pPSR1 [GenBank: NC_005205] [Browse all T4SS(s) in this replicon]
Location [Strand]56997..58028 [+]
Producthypothetical protein
Component typeVirB11
UniProt IDQ6VE79
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 8.7e-40, Aligned region: 25..316
Mg_chelatase [PF01078], Evalue: 3e-05, Aligned region: 150..198
Protein Sequence: 343 a.a.     [Download]
>gi|38257079|ref|NP_940733.1| hypothetical protein pPSR1_p48 [Pseudomonas syringae pv. syringae]
MTEEQGLTEDTLVLDFLDQAGATERLNRQGTKDVAINRPYELWVDGPNGWEHEEAPWLTYNLCWRLANAL
CALRYRVLTPHSPIHTVKLPGGERGQIVMAPACEEGTLSMTFRKPSLDRFTHMDYVNSGRYDRARAIASP
ILTLKAWQRDMQEAHAAGEWHRFMEIAIANRQNIIIFGGPGSGKTTYGKSLIDMFPVNRRMITIQEILED
PMPFHPNHVHLLYGHVVTPKALVASAMRMKPDHLFLAELTGDEVWHYIEILNTGTKGTVTTAHANDSEAG
YARVCGLVKQSPIGLGLDYAYIERLVRTSFDVVVYMENTYIEEVHYEPEHKLALLNGQRQRAA
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|38257032|ref|NC_005205.1|:56997-58028 Pseudomonas syringae pv. syringae A2 plasmid pPSR1, complete sequence
ATGACTGAAGAGCAAGGACTTACCGAAGACACGCTGGTCCTGGACTTCCTCGACCAGGCAGGTGCCACCG
AGCGCCTAAATCGTCAGGGCACCAAGGACGTGGCCATCAACCGGCCTTACGAGCTGTGGGTGGACGGTCC
AAACGGCTGGGAACACGAAGAAGCGCCTTGGCTCACCTACAACCTGTGCTGGCGGCTGGCCAATGCGCTC
TGTGCGCTGAGATACCGCGTACTGACTCCTCACTCACCTATTCACACTGTGAAATTACCTGGCGGGGAGC
GGGGCCAGATCGTCATGGCCCCGGCGTGCGAAGAGGGCACCCTGTCGATGACGTTTCGAAAACCCTCTTT
GGATCGCTTCACCCATATGGATTACGTCAACAGTGGCCGCTATGACCGAGCTAGGGCCATCGCTTCACCG
ATACTGACCCTGAAAGCCTGGCAGCGCGATATGCAGGAAGCCCACGCAGCTGGCGAGTGGCACCGATTCA
TGGAAATCGCCATCGCTAATCGCCAGAACATCATCATTTTTGGCGGGCCAGGGTCGGGTAAAACCACTTA
CGGCAAGTCGCTGATCGACATGTTTCCGGTTAACCGTCGCATGATCACGATCCAGGAAATACTGGAGGAC
CCCATGCCCTTCCATCCTAACCATGTGCATTTGCTCTATGGCCATGTGGTGACGCCCAAAGCCCTGGTGG
CCAGCGCAATGCGGATGAAGCCTGACCACCTGTTTTTGGCCGAGCTGACTGGTGATGAGGTGTGGCACTA
CATCGAGATTCTGAACACCGGCACCAAGGGCACCGTGACCACCGCGCACGCCAATGACAGTGAAGCAGGC
TACGCCCGTGTGTGCGGCCTGGTGAAGCAGTCACCAATCGGCCTCGGTCTGGATTACGCGTACATCGAGC
GCCTGGTGCGCACCTCATTTGACGTGGTCGTGTACATGGAAAACACCTACATCGAAGAAGTGCATTACGA
ACCCGAACACAAGCTGGCCTTGCTCAATGGCCAGCGTCAACGAGCTGCCTAG
 Primer design