SecReT4
Protein ID: 38257080
T4SS name [ID]VirB [432]
Gene symbolvirD4
Locus tagpPSR1_p49
StrainPseudomonas syringae pv. syringae plasmid pPSR1 (NC_005205)
Repliconplasmid pPSR1 [GenBank: NC_005205] [Browse all T4SS(s) in this replicon]
Location [Strand]58814..60472 [+]
Producthypothetical protein
Component typeVirD4
UniProt IDQ6VE78
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.4e-75, Aligned region: 25..471
TraG-D_C [PF12696], Evalue: 1.2e-25, Aligned region: 312..433
TrwB_AAD_bind [PF10412], Evalue: 2.1e-21, Aligned region: 308..445
Protein Sequence: 552 a.a.     [Download]
>gi|38257080|ref|NP_940734.1| hypothetical protein pPSR1_p49 [Pseudomonas syringae pv. syringae]
MARAKSKPKPISPTNPQKRIDEHPAFLLGKHPTEDSFLASYGQQFVMLAAPPGTGKGVGAVIPNLLSYPD
SMVVNDPKFENWEITSGFRASAGHKVYRFSPERLETHRWNTLSAISRDPLYRLGEIRTIARVLFVSDNPK
NQEWYNKAGNVFTAILLYLMETPEMPVTLPQTYEIGSLGTGIGTWAQQIIELRSIGPNALSFETLRELNG
VYEASKNKSSGWSTTVDILRDVLSVYAEKTVAWAVSGDDIGFAKMREEKTTVYFSVTEGNLKKYGPLMNL
FFTQAIRLNSKVIPEQGGHCPDGTLRYKYQLGLLMDELAIMGRIESMETAPALTRGAGLRFFLIFQGKDQ
IRDIYGENAANGIMKAIHNEIVFAPGDIKLAEEYSRRLGNKTVRVHNQSLNRQKHQVGAQGQTDSYSEQP
RALMLPQEVNELPYDKQLIFIQGTKTTPPLKILARKIFFYEEEVFKARANMPPPPLPVGDASKIDALTVP
VRTIEAKVAVADAKPMQAEQRQRWNPKDKASEVAQAEADKAQPVEVEPDPEPVQADDTSESM
 
Nucleotide Sequence: 1659 bp     [Download]
>gi|38257032|ref|NC_005205.1|:58814-60472 Pseudomonas syringae pv. syringae A2 plasmid pPSR1, complete sequence
ATGGCCAGAGCTAAATCCAAACCCAAACCCATCAGCCCGACCAACCCTCAAAAACGGATCGACGAGCATC
CCGCTTTCCTCTTGGGCAAGCACCCCACGGAGGATTCGTTTCTGGCCAGCTACGGGCAACAGTTCGTGAT
GCTGGCCGCACCACCGGGCACCGGGAAAGGGGTCGGGGCTGTGATCCCCAACCTGCTCAGCTACCCCGAT
TCCATGGTGGTCAACGATCCGAAATTTGAAAACTGGGAAATCACCTCGGGGTTTCGTGCATCAGCTGGTC
ACAAGGTCTACCGCTTTTCACCTGAGCGCCTGGAGACGCACCGCTGGAACACCCTTAGCGCGATCAGCCG
CGATCCGCTTTACCGGCTGGGAGAAATTCGCACGATCGCCAGGGTGCTGTTCGTCTCCGACAACCCCAAG
AACCAGGAGTGGTACAACAAGGCGGGCAACGTCTTCACGGCCATACTGCTGTACCTGATGGAAACGCCGG
AAATGCCCGTTACGTTGCCCCAGACCTACGAAATTGGCTCATTGGGTACCGGGATAGGGACGTGGGCTCA
GCAGATCATCGAATTGCGCAGTATCGGCCCTAATGCGCTCAGCTTTGAAACCCTTCGAGAGCTTAACGGT
GTGTACGAAGCCTCAAAAAACAAGAGCAGCGGTTGGTCCACCACCGTGGATATCCTGCGAGACGTGTTGT
CGGTGTATGCCGAAAAGACGGTGGCTTGGGCCGTATCAGGGGATGACATTGGCTTTGCCAAAATGCGTGA
GGAGAAGACCACCGTTTACTTTAGCGTGACGGAGGGAAACCTGAAGAAGTACGGCCCGTTGATGAACCTG
TTTTTCACTCAGGCCATACGGCTCAATTCCAAGGTCATCCCGGAGCAGGGTGGACACTGTCCAGACGGTA
CGCTTCGGTACAAGTACCAGTTGGGCCTATTGATGGATGAGCTGGCCATCATGGGCCGCATTGAAAGCAT
GGAAACCGCGCCTGCGCTGACCCGAGGTGCCGGTTTGAGGTTTTTCCTCATCTTTCAGGGTAAGGATCAG
ATCCGCGACATTTATGGCGAAAACGCTGCCAACGGCATCATGAAGGCGATTCACAACGAAATCGTGTTTG
CCCCCGGTGACATCAAGCTGGCCGAGGAGTACAGCAGGCGTTTAGGTAACAAGACTGTGCGTGTCCATAA
CCAATCGTTGAACAGACAGAAGCATCAGGTTGGGGCTCAAGGGCAAACAGACAGTTACAGCGAACAGCCC
CGGGCCTTAATGCTGCCGCAAGAGGTCAACGAACTGCCATATGACAAACAGTTGATCTTCATACAGGGAA
CCAAGACCACGCCCCCACTTAAGATTTTGGCCCGGAAGATTTTTTTCTACGAGGAAGAAGTGTTCAAGGC
GCGGGCCAACATGCCGCCACCGCCATTGCCTGTCGGTGATGCATCAAAAATCGACGCGCTCACCGTGCCG
GTGCGCACCATCGAAGCCAAGGTGGCAGTGGCCGACGCCAAGCCCATGCAGGCCGAACAACGGCAGCGCT
GGAATCCCAAAGACAAAGCGTCTGAAGTGGCTCAGGCCGAAGCGGATAAGGCACAGCCAGTTGAGGTCGA
GCCTGATCCAGAGCCTGTGCAGGCTGACGACACCTCGGAATCGATGTAG
 Primer design