SecReT4
Protein ID: 38347832
T4SS name [ID]Tra_F [577]
Gene symboltrhA
Locus tagSMR0004
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]2025..2378 [+]
Productputative pilin
Component typeTraA_F
UniProt IDQ6MY35
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 117 a.a.     [Download]
>gi|38347832|ref|NP_941081.1| putative pilin [Serratia marcescens]
MELSLNIGLSEKKSNTAALFKTKSAKVILFVLLTVLFCGLAYAGSDDGALGDIWSYMSESMTGAPGKILA
AAMLISSVYFSVLKPNPGLALVSLFMMLVMANGEKIISTFMDAGVPL
 
Nucleotide Sequence: 354 bp     [Download]
>gi|38347830|ref|NC_005211.1|:2025-2378 Serratia marcescens plasmid R478, complete sequence
ATGGAACTTTCTTTAAATATTGGCCTTAGTGAAAAGAAATCTAACACGGCTGCACTTTTTAAAACAAAAA
GCGCAAAAGTGATTTTGTTTGTTCTGCTGACCGTGCTTTTTTGCGGTCTGGCATATGCGGGTTCAGATGA
TGGGGCACTGGGAGATATTTGGTCATACATGAGTGAAAGTATGACTGGAGCTCCGGGCAAAATTCTGGCA
GCCGCGATGTTGATCTCAAGCGTATATTTCTCTGTCCTTAAGCCTAACCCGGGCCTGGCACTGGTTTCAT
TATTCATGATGCTGGTAATGGCCAACGGCGAGAAAATTATCAGCACCTTTATGGATGCTGGCGTACCGCT
GTAA
 Primer design