SecReT4
Protein ID: 38347833
T4SS name [ID]Tra_F [577]
Gene symboltrhL
Locus tagSMR0005
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]2396..2746 [+]
Productputative plasmid transfer protein
Component typeTraL_F
UniProt IDQ936A5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.6e-06, Aligned region: 22..92
Protein Sequence: 116 a.a.     [Download]
>gi|38347833|ref|NP_941082.1| putative plasmid transfer protein [Serratia marcescens]
MRGFIPLSGFLMSKQNDVPQHTYRFPFRINMPLLILFWDAKKLGLAFILVAFGNIFECFGFSVVAAVVYW
IAYNKAAESGIRGLLKHKLWWLGFLPGKAVFSSRYFNDPFIRDLYS
 
Nucleotide Sequence: 351 bp     [Download]
>gi|38347830|ref|NC_005211.1|:2396-2746 Serratia marcescens plasmid R478, complete sequence
ATGAGGGGGTTCATCCCCCTCTCTGGATTTTTAATGAGTAAGCAGAACGACGTTCCTCAGCATACCTATA
GATTCCCTTTCAGGATCAACATGCCTCTACTGATTTTGTTTTGGGATGCCAAAAAATTAGGGCTTGCATT
CATTCTGGTTGCATTTGGGAATATCTTCGAATGCTTCGGGTTTTCTGTTGTAGCAGCGGTTGTGTATTGG
ATTGCGTATAACAAAGCAGCTGAGTCAGGAATAAGAGGATTGCTAAAACACAAACTCTGGTGGCTCGGTT
TTTTGCCAGGTAAAGCAGTTTTTAGTAGCCGTTATTTCAACGATCCATTTATCAGAGATTTGTATTCTTG
A
 Primer design