SecReT4
Protein ID: 38347834
T4SS name [ID]Tra_F [577]
Gene symboltrhE
Locus tagSMR0006
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]2758..3546 [+]
Productputative pilus assembly protein
Component typeTraE_F
UniProt IDQ936A4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 3.9e-13, Aligned region: 73..199
Protein Sequence: 262 a.a.     [Download]
>gi|38347834|ref|NP_941083.1| putative pilus assembly protein [Serratia marcescens]
MKMLSGINIPFFKKSKKDENGDLEQSYVKKDESAKGRFLDIKKRFSPQAEASGAGITYSALINRDTKLIR
INTVSIAVIGLLVAKILFFTDPVTIVTPPNMNEEITVVGNKASESYKTQWALFFSTLLGNINPTNISFVT
AYVLDALSPELQAKTSESLQEQINIMQARGVEQTFKPNDIYFDPKNDMVYVWGTKTTRLVNVPDKTESSK
WTYEWVLGMKNGRPRIAYVNQYSGTPNIKKITINGKEQLATLDNPPPSTGNK
 
Nucleotide Sequence: 789 bp     [Download]
>gi|38347830|ref|NC_005211.1|:2758-3546 Serratia marcescens plasmid R478, complete sequence
ATGAAAATGCTAAGTGGCATTAACATCCCTTTTTTCAAAAAATCTAAAAAGGATGAAAACGGTGATCTTG
AACAGTCATACGTAAAGAAAGATGAAAGTGCTAAGGGACGTTTTTTGGACATTAAAAAACGATTTAGCCC
ACAAGCTGAAGCGTCAGGTGCTGGAATTACATACAGCGCCCTGATTAATCGTGATACAAAACTTATCCGC
ATTAATACTGTTTCAATAGCCGTCATTGGGTTATTGGTTGCAAAGATTCTTTTTTTCACTGACCCAGTGA
CGATTGTTACCCCTCCAAACATGAATGAAGAGATCACGGTTGTTGGTAACAAAGCATCGGAATCTTATAA
AACACAATGGGCTCTCTTTTTTAGTACCCTTTTAGGGAATATTAATCCAACTAATATTTCCTTTGTGACG
GCCTATGTCCTCGATGCCCTTTCACCTGAACTACAGGCTAAAACGAGTGAGTCTTTACAGGAGCAGATAA
ATATCATGCAGGCTCGTGGTGTTGAGCAGACCTTTAAGCCTAATGATATTTACTTTGATCCAAAAAATGA
CATGGTCTATGTCTGGGGTACCAAAACGACTCGACTTGTAAATGTTCCGGACAAAACTGAATCATCGAAA
TGGACTTATGAATGGGTTCTCGGGATGAAAAATGGTCGCCCAAGAATTGCATATGTAAATCAATATTCCG
GAACACCGAATATTAAAAAAATTACGATAAACGGCAAAGAGCAACTGGCAACGCTGGATAATCCGCCACC
GTCTACAGGTAACAAGTGA
 Primer design