SecReT4
Protein ID: 38347835
T4SS name [ID]Tra_F [577]
Gene symboltrhK
Locus tagSMR0007
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]3546..4817 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDQ936A3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1.6e-10, Aligned region: 163..401
Protein Sequence: 423 a.a.     [Download]
>gi|38347835|ref|NP_941084.1| hypothetical protein SMR0007 [Serratia marcescens]
MIKKKGLGFNAITALIMLTTSNCVIAEEYQLPATINNPVVMPVGADGFQNGAAKAIIPGQAGSEQSGAQT
NLSEAGNAQGQKPTTDLPTVQLSPASNASPAVSAITGALSNNPSLPGFDAQTRSGAIDSYGRPTGTSSQQ
NATNATATSKADELYVEARNRYKEVQRVNVPPGGNVVLPVSRGLQNRISTSFKNASVSTSTPAEEASIFV
NGGDVFISTNTDKPIGIMLSEDQVPESTYNLTLVPLDVPGAMISVTTSLSPSMQAKRETSLDKQNYEEML
ARSQSEELAPTDPKQDDHKQRIIDLLTPVALGEVPSGFSLQQDRLSRIPAPEQSPCNFNMYAKLGQRLVG
SRELIDVILVKNDKPYGQIVADQQCMAEGVIASALFDKAYLQPGEETELYIVRDKLFKEREARVTTRPSL
IRK
 
Nucleotide Sequence: 1272 bp     [Download]
>gi|38347830|ref|NC_005211.1|:3546-4817 Serratia marcescens plasmid R478, complete sequence
ATGATTAAAAAAAAGGGCTTAGGCTTCAACGCAATTACAGCATTGATCATGCTCACGACTTCGAACTGCG
TAATCGCTGAAGAATACCAATTGCCAGCAACAATTAATAACCCGGTTGTAATGCCAGTTGGTGCTGACGG
ATTTCAGAATGGAGCTGCAAAAGCCATTATTCCGGGTCAAGCTGGTTCTGAACAGTCAGGTGCACAAACA
AACCTTAGTGAAGCCGGTAATGCGCAGGGACAAAAACCTACAACTGATCTCCCTACCGTGCAACTTTCCC
CAGCCAGCAATGCTTCGCCTGCGGTAAGCGCTATTACTGGAGCATTATCAAATAATCCTAGTCTCCCCGG
ATTTGACGCACAGACCCGATCTGGTGCAATTGATAGCTATGGGAGACCAACAGGTACCTCTTCCCAGCAG
AATGCAACCAATGCGACCGCCACGTCAAAAGCCGATGAACTTTATGTCGAAGCTCGTAACCGATATAAAG
AAGTTCAGCGTGTAAATGTGCCGCCTGGTGGGAATGTGGTACTGCCAGTTTCACGAGGACTTCAAAACAG
AATATCGACCAGCTTCAAGAATGCTTCTGTCAGTACTTCTACCCCTGCTGAAGAGGCAAGCATATTTGTT
AATGGTGGCGATGTCTTTATTTCAACTAATACCGATAAACCAATCGGGATTATGTTGTCTGAAGATCAGG
TACCTGAATCGACCTATAACCTGACCCTGGTACCGCTTGATGTTCCCGGTGCGATGATTTCAGTTACTAC
ATCTTTAAGCCCATCTATGCAAGCCAAACGTGAAACCTCATTGGATAAGCAAAACTATGAGGAAATGTTG
GCCCGCTCCCAGTCAGAAGAACTGGCTCCAACGGATCCAAAACAAGACGATCATAAACAAAGAATCATTG
ATTTATTGACTCCTGTGGCTCTTGGTGAGGTCCCTTCAGGATTCAGTTTACAACAGGACCGACTTTCTCG
TATTCCTGCGCCAGAGCAGTCACCATGTAACTTTAATATGTATGCAAAGCTCGGTCAGAGACTGGTTGGC
TCACGTGAACTTATTGATGTAATTCTTGTGAAAAACGATAAACCATACGGTCAAATCGTTGCTGATCAGC
AGTGTATGGCAGAAGGCGTTATTGCAAGTGCTTTATTTGATAAAGCATACCTGCAACCGGGAGAAGAAAC
AGAGCTTTACATAGTCCGGGATAAATTGTTCAAGGAACGCGAGGCCCGGGTTACAACCAGACCAAGTCTA
ATCAGAAAATAA
 Primer design