SecReT4
Protein ID: 38347837
T4SS name [ID]Tra_F [577]
Gene symboltrhB
Locus tagSMR0009
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]5270..6625 [+]
Productputative transfer protein
Component typeTraB_F
UniProt IDQ9Z4H6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.6e-39, Aligned region: 239..442
Protein Sequence: 451 a.a.     [Download]
>gi|38347837|ref|NP_941086.1| putative transfer protein [Serratia marcescens]
MDIKKAWENKTVRLSVIGALLVVIVYIISQSIFSTPVKKEKKTQKKDMQTNLLLDDSQMNKLSNEESQKV
YKEMVKQNRLDQNAAKEDREKAEKAQQETKAQVASLTSQLQQLSQQINDMQTNRNGNRNLDAGSSRKTIN
EQAPAAPYQLNANAPINGVNPNYASITPTRNSPMRTITQSSIKTNGTDGVIQVMPVSENRIKEGREVIAG
DKAPTRTVRGDGTAPVDSKARHAARKDEMFLPATSIITGVLITGLEAPTSLSSKSEPMPVTMRIKKDVIM
PNNFTMDLRDCNLLGSAVGDLASQRAYIRATSISCVNSKGKAFDVKLEAYAVSENDGKNGIRGTLISRNG
NAIAGAAFAGGLSSLAGSLSPSKVSSLNIDPNSQAQYQSPNFGALGALAGAGAAQGGLNRLVDYYTAIAE
QQWPIVEISPGRAITFVVQTGTTIPTNLTSR
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|38347830|ref|NC_005211.1|:5270-6625 Serratia marcescens plasmid R478, complete sequence
ATGGACATTAAAAAGGCCTGGGAAAATAAGACCGTCAGACTTTCTGTTATTGGCGCTCTGCTGGTAGTGA
TTGTTTATATTATTAGCCAGTCTATTTTTTCCACACCAGTTAAGAAAGAAAAGAAAACACAGAAAAAAGA
CATGCAGACCAATTTGTTGTTAGATGATTCGCAAATGAACAAATTGAGTAATGAAGAAAGCCAGAAAGTA
TATAAAGAAATGGTTAAGCAAAACCGACTTGACCAAAATGCGGCGAAAGAGGACCGCGAAAAAGCAGAAA
AAGCCCAACAGGAAACTAAAGCCCAAGTTGCAAGTTTAACTTCTCAACTTCAGCAGCTGTCTCAGCAAAT
TAATGATATGCAGACAAATCGAAACGGCAATCGTAACTTGGATGCTGGTAGTTCGCGTAAAACGATTAAT
GAGCAGGCACCGGCAGCTCCTTATCAGCTTAATGCTAATGCGCCGATTAATGGCGTAAACCCTAATTACG
CTTCTATCACACCTACGCGTAATAGCCCAATGAGAACAATCACACAAAGTTCCATTAAGACTAATGGTAC
CGATGGTGTCATTCAGGTTATGCCCGTGTCTGAAAACAGAATCAAGGAAGGCAGAGAGGTCATTGCAGGA
GATAAAGCGCCAACTCGGACTGTACGAGGTGATGGTACTGCGCCAGTTGATAGCAAAGCGCGGCATGCTG
CCCGAAAAGATGAAATGTTTCTTCCGGCAACATCTATTATCACTGGTGTTCTGATTACCGGGCTTGAAGC
GCCTACAAGCCTTTCTTCCAAATCAGAACCAATGCCAGTAACGATGCGTATTAAAAAAGATGTCATCATG
CCCAATAATTTCACCATGGATTTGCGTGACTGTAATCTTCTGGGTTCAGCTGTTGGTGATCTGGCGTCAC
AGCGTGCTTACATACGTGCCACTTCTATCTCTTGTGTTAATTCAAAAGGGAAAGCTTTTGACGTAAAACT
GGAAGCATATGCTGTAAGTGAAAATGACGGAAAAAATGGGATCCGAGGCACGCTTATCAGCCGAAATGGT
AACGCAATTGCAGGAGCTGCATTTGCCGGTGGACTTTCTTCACTTGCCGGTAGCTTAAGTCCCAGTAAGG
TATCTTCACTTAACATCGACCCTAATTCACAGGCTCAGTATCAGTCCCCTAATTTTGGTGCACTTGGGGC
ATTAGCCGGGGCTGGTGCAGCTCAAGGTGGTCTTAATCGACTCGTCGATTACTACACCGCAATTGCAGAA
CAACAGTGGCCAATCGTAGAAATTAGCCCTGGCCGAGCTATTACATTTGTCGTTCAGACCGGAACTACAA
TTCCAACGAATCTGACCAGTCGCTGA
 Primer design