SecReT4
Protein ID: 38347840
T4SS name [ID]Tra_F [577]
Gene symboltrhV
Locus tagSMR0012
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]7996..8946 [+]
Productputative plasmid transfer protein
Component typeTraV_F
UniProt IDQ9Z4H4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 7.4e-12, Aligned region: 27..271
Protein Sequence: 316 a.a.     [Download]
>gi|38347840|ref|NP_941089.1| putative plasmid transfer protein [Serratia marcescens]
MNIKRLVLSALVVGTSSYLTGCSIGSSESECPGIEKGVICKGPREVMELTNNRDDLSALAGEESESGKEK
SAVNDSRYPTEISPPGEVKYPQSTTLKNQPVAYSKTEIKPVGQLPVMYDKTLKMGAPTSSIGPRPISGVP
VNSNVRMTSSYSTASSTGNPFVHPAAEVVKQTSYPVSAGNAPRYVAPNSDISPGKDMYSLYNGQPVNPTL
NPGQIQQYRSQGYKQAVVAPEPLAVLQQGKVMRITFAPYTDDNDALNLPGYVYVNVKPQTWIAGKNSTSN
PARIVPLEVQDAARENMQQQQKATKAVSSNGIVRQL
 
Nucleotide Sequence: 951 bp     [Download]
>gi|38347830|ref|NC_005211.1|:7996-8946 Serratia marcescens plasmid R478, complete sequence
ATGAACATCAAAAGATTGGTACTCAGTGCTCTGGTTGTAGGTACATCCTCATATCTTACGGGGTGCTCCA
TCGGTAGTTCCGAATCCGAATGTCCAGGCATTGAAAAGGGCGTTATCTGTAAAGGTCCTCGCGAAGTTAT
GGAGTTAACTAATAATCGAGATGATCTGTCTGCACTGGCGGGGGAAGAGTCGGAATCGGGAAAGGAGAAA
TCGGCTGTCAATGACAGCCGTTATCCAACTGAAATTAGCCCTCCAGGGGAAGTCAAATATCCACAGTCTA
CTACCCTTAAAAATCAGCCTGTGGCTTATTCAAAAACCGAAATTAAGCCAGTTGGTCAGTTACCTGTCAT
GTACGATAAAACTTTAAAAATGGGTGCCCCTACTTCATCCATTGGACCACGGCCTATTTCTGGTGTACCG
GTTAATTCAAACGTAAGGATGACTAGCAGTTATAGCACTGCCTCTTCAACTGGTAACCCTTTCGTTCATC
CGGCTGCGGAAGTCGTTAAACAAACAAGCTATCCGGTTTCTGCTGGAAATGCCCCACGCTACGTTGCACC
TAATTCTGATATCAGCCCTGGTAAGGATATGTACTCTCTTTACAATGGCCAGCCCGTTAACCCGACTCTC
AACCCTGGGCAGATCCAGCAATACCGTTCGCAAGGTTATAAACAAGCTGTAGTGGCTCCTGAACCACTTG
CTGTTCTGCAACAGGGGAAAGTAATGAGAATTACTTTTGCACCTTATACCGATGATAACGATGCGCTTAA
TCTTCCCGGCTACGTTTATGTCAACGTAAAACCGCAAACATGGATTGCTGGCAAGAATTCGACCTCAAAC
CCAGCTCGCATAGTTCCTTTAGAAGTACAGGATGCGGCCCGGGAAAATATGCAGCAGCAACAAAAAGCAA
CTAAAGCTGTCTCTTCGAACGGCATTGTTAGACAACTGTAA
 Primer design