SecReT4
Protein ID: 38347841
T4SS name [ID]Tra_F [577]
Gene symboltrhC
Locus tagSMR0013
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]8955..11636 [+]
Productputative pilus assembly protein
Component typeTraC_F
UniProt IDQ9Z4H3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-57, Aligned region: 456..812
TraC_F_IV [PF11130], Evalue: 5e-49, Aligned region: 13..258
Protein Sequence: 893 a.a.     [Download]
>gi|38347841|ref|NP_941090.1| putative pilus assembly protein [Serratia marcescens]
MEAINNYNSGLNRHQLGGFIPVYDQLAGTHYFLIDGNRLGFMFICNPSPGVFDNQQDVLAEMFKMDFPTD
TVCQISLTALPDLTLQLSAWSAVRGGRMTGNDKLKADLLNGYQLDYYDRSMHKPLKPDHDNLMLRDFQVW
ISLSIPLQSALPTELEHSRIDSLYSELVSKLITIGLHPFKVDAENWLYCIDKVVNPGKNSRWAEGFIDVN
TMKRLNEQVNVPGRKYTVTENHFSSVTQSDDESEHRYFKQLSVVKFPEYVNFGCMYELVVNWMHGRKTIF
SPFMITQTVQFADPLKLSKENVRYKAITNKQASIPSVVTFCPRLRDMDNDYMAVTRELEDGAKLLRGYLT
FTVMGSNANSVQTAANDLKSFYLESRVKVADDSFIVFPSFMSCLPMCNDPKTIFDLDRSEVVSNTGAAHM
TPIFGPWKGNTDRPVLSLVSREGQLMGLDIFKTSASYNMVIGATSGAGKSFWTAYLINNYLGAGPRSNNL
VHYRSTFKHFLENEYPDDDPDGAQVFVVDVGRSYQGIAEQYTNSQFIDFGKTPDFTLNPFAFLTDITVND
DVFNEAPEFTGESTSNDAEKDKVAQTIMVLNQLKIMASEKGLIDDYQQSVMLQLIAEEYQESRKSGRTGS
ITGFALRCKKHEDKRIKDIGEQLGAWCEGGIYGHRFTDTLPPINFDSRFIVLELEELKGTPHLQTVVLMS
IIQAAQHAMFIKKDGRRRLFILDEAWEYIRPDNSSGAGNQSNQFFSSFLEAAWRRFRKTNCAGICITQSF
EDYFTSSVGRALTANSPWKIIMKQEKESIEAMKANKYFSTSDAEYERMKNIRTVKKVFSEMLVRFENFQE
ICRLYVDRKMELCFTTDSADRSKLWEIQSRENCSYGEAIEILYAQEVAAGLAA
 
Nucleotide Sequence: 2682 bp     [Download]
>gi|38347830|ref|NC_005211.1|:8955-11636 Serratia marcescens plasmid R478, complete sequence
ATGGAAGCTATCAATAATTACAATAGCGGTTTAAATCGCCATCAATTAGGTGGGTTTATCCCTGTTTACG
ATCAATTAGCAGGGACTCACTATTTTTTGATTGATGGCAACAGATTAGGGTTTATGTTTATCTGTAATCC
ATCCCCTGGAGTTTTTGATAATCAGCAAGATGTTCTTGCTGAAATGTTCAAAATGGATTTCCCTACAGAT
ACTGTCTGTCAAATATCTCTGACTGCATTGCCAGACCTGACTTTACAGCTTAGTGCTTGGTCAGCTGTGC
GAGGTGGGCGTATGACTGGGAACGATAAGCTTAAAGCAGATCTGCTTAATGGTTATCAGTTGGACTACTA
CGACAGAAGTATGCATAAGCCTTTAAAACCTGATCATGATAACCTTATGTTGAGGGATTTTCAGGTATGG
ATCTCGCTATCGATTCCTTTACAGTCTGCCCTTCCTACCGAGCTGGAACATTCGCGTATCGATTCACTTT
ACTCTGAACTTGTAAGTAAGTTAATTACGATTGGATTGCATCCGTTTAAGGTCGATGCAGAAAACTGGCT
CTATTGTATAGATAAGGTCGTAAACCCCGGAAAGAACTCCCGGTGGGCTGAAGGTTTCATAGACGTTAAC
ACTATGAAAAGGCTTAATGAACAAGTTAACGTTCCCGGCCGTAAGTATACAGTCACAGAAAATCATTTCT
CATCAGTCACACAAAGTGACGACGAATCTGAGCATCGTTACTTCAAACAACTTTCCGTTGTAAAGTTTCC
TGAATACGTCAATTTCGGTTGTATGTATGAGTTAGTAGTTAACTGGATGCATGGACGTAAGACAATTTTC
AGCCCATTTATGATCACTCAGACTGTTCAGTTTGCCGATCCGCTCAAGTTGTCAAAAGAAAACGTCCGCT
ACAAAGCAATCACTAATAAACAGGCAAGTATACCTTCAGTTGTCACATTCTGCCCTCGCCTGCGGGATAT
GGATAATGACTACATGGCCGTAACTCGCGAGCTTGAGGATGGCGCAAAGCTTTTAAGAGGGTATCTTACT
TTCACTGTTATGGGTAGTAATGCCAATTCTGTGCAGACAGCAGCTAACGATCTCAAATCCTTTTACCTCG
AAAGCCGGGTCAAAGTAGCAGATGATTCCTTTATCGTTTTCCCGTCATTTATGTCATGTCTGCCAATGTG
CAATGACCCAAAGACAATTTTCGACCTTGACCGTTCCGAAGTAGTGAGCAACACCGGAGCGGCTCATATG
ACACCGATCTTTGGGCCCTGGAAAGGTAATACAGATAGACCAGTACTGAGTTTAGTTTCTCGTGAAGGTC
AACTCATGGGACTTGATATTTTCAAGACTTCTGCAAGCTATAACATGGTTATTGGTGCAACGTCAGGTGC
AGGGAAGTCATTCTGGACAGCATATCTAATCAATAACTATCTTGGAGCTGGACCGCGATCTAATAACCTC
GTTCATTATCGCTCAACATTTAAGCATTTTTTAGAAAACGAATACCCAGATGATGATCCTGACGGTGCTC
AAGTATTTGTTGTGGACGTGGGCCGTTCTTACCAGGGGATTGCGGAACAATATACAAACAGTCAATTTAT
TGATTTCGGTAAAACCCCTGACTTCACCCTAAATCCCTTTGCCTTCCTAACTGACATCACTGTTAACGAC
GATGTATTTAACGAAGCACCTGAATTTACCGGTGAATCAACTTCAAACGATGCAGAAAAAGACAAAGTTG
CTCAGACCATAATGGTTTTGAATCAGCTAAAAATTATGGCTTCAGAGAAAGGCCTTATCGATGATTATCA
ACAATCAGTGATGCTTCAGCTTATTGCAGAAGAGTACCAAGAATCCAGAAAATCAGGTCGGACCGGTTCA
ATAACCGGCTTTGCTCTGCGTTGCAAGAAGCATGAAGACAAACGTATAAAGGATATTGGGGAGCAACTCG
GAGCATGGTGCGAAGGTGGAATTTATGGGCACCGGTTTACCGATACGTTGCCTCCAATCAACTTCGACAG
CAGATTTATTGTTTTGGAACTGGAGGAGCTAAAAGGCACCCCCCACCTTCAGACAGTTGTATTAATGTCT
ATCATTCAGGCTGCTCAGCATGCAATGTTCATCAAAAAAGATGGGCGTCGTCGCTTGTTCATCCTTGATG
AAGCATGGGAGTACATTCGTCCTGATAATTCATCAGGTGCCGGAAATCAATCAAACCAATTCTTCTCTTC
CTTCCTCGAAGCGGCATGGCGTAGGTTCAGGAAAACAAACTGCGCTGGCATCTGTATCACACAGTCGTTT
GAAGATTATTTTACTTCTTCTGTTGGCCGGGCCCTGACTGCTAACTCGCCTTGGAAGATAATCATGAAAC
AAGAAAAAGAAAGCATTGAAGCAATGAAGGCTAATAAATATTTTTCTACTTCAGATGCAGAATATGAACG
TATGAAAAATATTCGTACAGTCAAAAAGGTGTTTTCAGAGATGTTAGTCAGGTTCGAAAACTTCCAAGAG
ATCTGTCGGTTATACGTAGACCGGAAAATGGAGCTTTGTTTTACTACGGATAGTGCTGACAGGAGTAAAT
TATGGGAAATTCAAAGCCGCGAGAATTGTAGCTATGGCGAGGCAATAGAAATTCTCTATGCTCAAGAAGT
AGCAGCGGGTTTGGCCGCGTAG
 Primer design