SecReT4
Protein ID: 38347855
T4SS name [ID]Tra_F [577]
Gene symboltrhW
Locus tagSMR0027
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]29556..31067 [+]
Productplasmid exported transfer protein
Component typeTraW_F
UniProt IDQ6MY12
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.3e-22, Aligned region: 196..277
Protein Sequence: 503 a.a.     [Download]
>gi|38347855|ref|NP_941104.1| plasmid exported transfer protein [Serratia marcescens]
MRSFNVNKKYLPILPGLALCAVLSNTNASTEYQHDADLIAQQAKGLGAQAKGAQQPDGALSLDATLKSPD
VQKYIAQAEALQKNQDLSKQINRGYVPGMNADSVQAVIDHTQAIRAQSNNSEAVNDIIRRRDEIQENASL
NEAALKAVENKPEVMRGQSKNIEKLFGSSGITAADFERKMDSTREEALSTENGITIFASFSLPDYVLEDL
LRTASEHKARVVFNGLKKGTTRLPETQAAINQMIVKGKFESPLITIDPDSFSQYQVTQVPTIISREQARF
AKMVGSFNVEFFQRELAKKPDQDIFPVAGTTYPVEEKSIIKELEERAQKYDWEGAKKRAVSDTWKNQWMV
DLPPAQEHKEFLIDPTVRVTQDVKDKQGRVIASAGELINPLSRFPQNLTMIIFDPLNPGQLVWAEQQYRQ
RLGSGKVMPMFTRIQKDNGWDHLNDLREKFNGKVFKVNEQIISRFQIKNTPALITTDQDKFRITLFSEAE
VRGIGAPNLSEEK
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|38347830|ref|NC_005211.1|:29556-31067 Serratia marcescens plasmid R478, complete sequence
ATGCGATCTTTTAATGTAAATAAAAAATATTTACCAATACTTCCTGGACTTGCGTTATGTGCAGTTTTAA
GTAATACAAATGCAAGCACTGAGTATCAACATGATGCTGACCTAATCGCTCAGCAAGCAAAAGGGCTTGG
GGCACAGGCTAAAGGTGCACAGCAGCCAGATGGGGCTCTTAGCCTTGATGCTACGCTAAAATCACCAGAT
GTGCAGAAGTACATAGCGCAAGCTGAAGCACTCCAAAAAAACCAGGACCTGAGCAAGCAAATAAACCGTG
GTTACGTCCCCGGTATGAATGCGGATAGTGTTCAAGCAGTTATAGACCATACCCAGGCTATCAGGGCCCA
AAGTAATAACTCTGAAGCTGTCAACGATATAATTAGAAGACGTGATGAAATTCAAGAAAACGCCAGCCTT
AATGAAGCGGCTCTGAAAGCTGTGGAAAATAAGCCGGAAGTCATGCGAGGACAATCTAAAAATATCGAAA
AATTGTTTGGTTCCTCGGGCATCACAGCTGCTGACTTCGAAAGAAAAATGGATAGCACACGTGAAGAAGC
ACTATCAACTGAAAATGGAATAACGATCTTTGCTTCATTTAGCTTGCCGGATTATGTACTGGAAGACCTT
CTACGTACGGCCTCAGAGCATAAAGCTCGTGTAGTTTTCAATGGTCTAAAGAAAGGAACTACTCGGCTAC
CAGAGACACAGGCAGCAATAAACCAAATGATTGTCAAAGGAAAATTTGAATCTCCTTTGATTACAATTGA
TCCTGATAGCTTCAGTCAGTATCAAGTAACTCAAGTACCGACAATTATTTCTAGGGAGCAAGCTCGTTTT
GCAAAAATGGTAGGCTCCTTCAACGTTGAGTTTTTTCAGCGAGAACTTGCTAAAAAACCCGATCAGGATA
TTTTCCCGGTTGCTGGTACCACTTATCCCGTTGAAGAAAAGAGCATCATTAAAGAACTGGAAGAACGTGC
ACAAAAATATGACTGGGAAGGTGCAAAAAAAAGGGCCGTTTCTGACACATGGAAAAATCAATGGATGGTC
GACCTCCCTCCTGCCCAGGAACACAAAGAATTTTTAATTGACCCTACAGTGAGGGTCACTCAGGACGTAA
AAGATAAGCAGGGCCGTGTAATAGCTTCCGCCGGTGAGTTGATTAATCCACTTTCGAGATTTCCTCAAAA
CCTGACGATGATAATTTTCGATCCACTCAATCCGGGCCAGCTGGTATGGGCTGAGCAGCAGTATCGACAA
CGTCTGGGTAGTGGAAAAGTAATGCCAATGTTTACCCGTATCCAAAAAGATAATGGATGGGATCACCTAA
ATGATTTACGTGAAAAATTTAACGGTAAGGTGTTTAAAGTTAACGAACAGATTATCTCACGCTTTCAGAT
TAAAAACACACCTGCGCTTATAACTACTGACCAAGATAAATTCCGGATCACCCTGTTTAGCGAGGCAGAA
GTCCGTGGTATCGGAGCCCCAAATCTTTCAGAGGAAAAATAA
 Primer design