SecReT4
Protein ID: 38347856
T4SS name [ID]Tra_F [577]
Gene symboltrhU
Locus tagSMR0028
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]31206..32267 [+]
Productplasmid exported transfer protein
Component typeTraU_F
UniProt IDQ6MY11
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.5e-71, Aligned region: 49..348
Protein Sequence: 353 a.a.     [Download]
>gi|38347856|ref|NP_941105.1| plasmid exported transfer protein [Serratia marcescens]
MMVKKFKKLLLEFIVAVMLSLSIPGMAMAADAGVPGAMCQSAGVWQGLIKNICWSCIFPMRIMGIGAAPE
GAAPSRPGCYCTDQNGVPEIGWQLSFFQPVKIVEVVKSPWCSPFLEGTMLQKSQFDIGKSNTNQPMTATE
AGFYDVHLWEFPIMTMLKLLIIGECTAEPYIDASLTYISEVDPMWESDLLTLVLNPEAVVFANPIASMVC
AADCVAVTAGKDNLAAYFCAGCDGNLYPLTGHIYANDDAVRTSSLITQRLLTKLHRQGMLMRTMGADAMC
EKTWEYFTPRSQYRLSMLFPTPEAKGPDCCHRLGDSVHDWSTLKGGRKKIGNDNYVYMLWRYNDCCVRYI
PGA
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|38347830|ref|NC_005211.1|:31206-32267 Serratia marcescens plasmid R478, complete sequence
ATGATGGTGAAAAAATTCAAAAAGTTACTTTTAGAGTTCATTGTAGCAGTTATGCTTTCGCTTTCTATAC
CGGGTATGGCTATGGCAGCAGATGCTGGAGTCCCTGGGGCTATGTGTCAGTCAGCTGGAGTGTGGCAGGG
CTTGATTAAGAATATCTGTTGGAGCTGCATTTTTCCCATGAGGATAATGGGCATAGGGGCAGCTCCAGAA
GGCGCTGCTCCTTCACGTCCGGGTTGCTACTGCACAGATCAGAACGGCGTACCGGAAATAGGTTGGCAAT
TGAGCTTCTTTCAGCCGGTGAAGATTGTAGAAGTTGTAAAGAGCCCCTGGTGCAGCCCCTTTCTTGAAGG
CACGATGCTTCAAAAATCGCAGTTTGATATTGGTAAAAGCAACACAAATCAGCCAATGACAGCAACTGAA
GCCGGATTTTACGATGTTCATCTTTGGGAGTTCCCAATCATGACAATGCTCAAATTACTGATTATTGGCG
AGTGCACTGCTGAACCCTATATAGATGCCAGCCTGACCTATATAAGCGAAGTGGACCCTATGTGGGAAAG
TGATCTGCTTACACTCGTCCTGAATCCAGAGGCAGTAGTTTTTGCAAACCCAATTGCCTCAATGGTGTGC
GCTGCTGACTGTGTAGCAGTAACAGCAGGAAAGGATAATCTCGCTGCATACTTTTGTGCCGGATGCGATG
GCAACCTTTATCCATTAACCGGCCACATTTACGCAAATGATGACGCTGTAAGGACGAGTTCACTGATAAC
CCAGCGTCTTCTGACTAAACTACATCGCCAGGGAATGCTGATGCGAACGATGGGAGCAGACGCAATGTGT
GAGAAAACGTGGGAATACTTTACACCTCGTTCCCAGTATCGGCTTTCAATGCTTTTCCCAACTCCTGAGG
CGAAAGGGCCGGATTGCTGTCATCGTCTTGGTGATTCGGTACATGACTGGTCAACCCTTAAAGGTGGGCG
CAAAAAAATAGGCAATGATAATTATGTCTATATGTTGTGGCGTTACAATGACTGTTGCGTCAGATATATA
CCAGGCGCTTGA
 Primer design