SecReT4
Protein ID: 38347857
T4SS name [ID]Tra_F [577]
Gene symboltrhN
Locus tagSMR0029
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]32286..35474 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDQ6MY10
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 4.9e-24, Aligned region: 531..745
TraN [PF06986], Evalue: 4.9e-24, Aligned region: 872..939
Protein Sequence: 1062 a.a.     [Download]
>gi|38347857|ref|NP_941106.1| conjugal transfer mating pair stabilization protein TraN [Serratia marcescens]
MKLRKTIASTIIASMIANTMSWAFYISLINMVMTPRIYAADAIFDQLESNFNLANPNANRNATTSAQDIV
EKYKNADSGENVSGKITEKYVGKAESANLNLGKYGAGNSNESVMKNAASDGKSIGSAVQLPSMSGGTINS
NYTKEGAKLLSRDANGNIGISSNPNTTPGTKTNTGEIFSSEQKHSDIKFNAADRYGDEDGFVNDIKNRKS
QLFDAQSYDGVAYRTLVNANKDNPASSIKPNDPMFTAGRNEITNAVAGTGNWLQNCNVETSKKTVTTHYP
DYKEFYCNSPKQDNFSSCTITRDFSVPVYISGGNGDMSMCGDNCVRIWFGRRDDNYWSDGVYDNELTLKF
HPDAKLASAKIVNAEWDDHMRVTLDGTQIFAHIDGAYRESDYPAPKGSWELKKSWKLDKVYDVTDKVRKS
VYEEPDREVTMASRVWVGGKGEGYFEVELTFENMKLEDKHVQEPAGCYDAVQAPNTFCRFDRFKDMDVGT
KRLPESVLSLAKPLYEGDKGFLTWKTNLEGYFCDPLAKDKICSYDASGKIMKDANGKDLCYNYEEIKSMP
DACSAYKNDAACVLDKQTCAEGWFDEGTNSCYMYEQKYTCDRGKDVVREVESSTNACVGMIPCSGGTCET
GPKEENNDFGKVAAYSNMVQYMQGEAKCEDPNDANSCSVFEGKPEWCGRSVGFVNGLAKTDCCEAPQGTA
GALEGIMLAGSMIRNTNWTRVNAQLIKWTGGDTGTWASMSNAVGEWTASAGKTVGQMWNNVTSSLTSVYE
NVAGNLSRAVGSSATSGGAGGAGQLAQETMSSFGIGQLKQMAMKKAYELLPDTVRDFVFKNVATTGGEVV
FSAAVQNFMLALNVIGWIYTAYQVTKMLLEMLVACDQKEMEASIHKNQKSCFTLDTERCVKYLNVGFTKK
CVKKATDMCCYNSMLSRVIMQQAYPQLGIDPVASNCVGLSIKQIQQLDFDKIDLTEWINDAVQVGEVPDQ
YSKFSEESIVENLPFQNENYQLPSERTKEAMGGEENMIKARQENAQAIKEENVDCSYLPRPAICEVGSTT
LDPVTGKQLPKY
 
Nucleotide Sequence: 3189 bp     [Download]
>gi|38347830|ref|NC_005211.1|:32286-35474 Serratia marcescens plasmid R478, complete sequence
ATGAAACTTAGAAAAACGATAGCTTCAACTATTATTGCATCAATGATTGCCAATACTATGAGTTGGGCTT
TTTATATCTCTCTCATAAATATGGTAATGACTCCTCGTATTTATGCGGCAGACGCTATATTTGACCAGCT
CGAAAGTAACTTTAATCTTGCTAATCCTAACGCAAATCGCAATGCGACAACCAGTGCTCAGGACATTGTT
GAGAAGTACAAGAATGCGGATTCAGGCGAGAATGTCAGTGGGAAGATCACCGAGAAATACGTGGGTAAAG
CCGAATCCGCTAATCTTAATCTCGGAAAGTATGGGGCAGGGAACTCAAATGAAAGTGTCATGAAAAATGC
CGCATCCGATGGAAAGTCCATTGGTAGCGCCGTACAACTGCCGAGTATGTCTGGAGGGACAATCAATTCA
AACTATACCAAGGAAGGGGCAAAGCTGCTCTCTCGGGATGCTAATGGCAACATTGGTATAAGCAGTAATC
CCAATACTACTCCTGGAACCAAAACAAATACCGGAGAGATTTTCAGCTCAGAGCAAAAGCACAGCGATAT
TAAGTTCAATGCCGCAGATCGTTATGGGGATGAGGATGGCTTTGTAAACGATATAAAGAATCGGAAAAGC
CAGTTATTTGATGCTCAAAGTTATGATGGCGTTGCCTACCGCACCCTCGTAAATGCTAACAAGGACAACC
CGGCATCATCTATAAAGCCTAACGATCCCATGTTTACTGCGGGGAGAAATGAGATAACAAATGCTGTTGC
TGGTACTGGAAACTGGCTTCAGAACTGTAATGTTGAGACCTCTAAAAAAACAGTAACCACACACTATCCT
GATTACAAAGAGTTCTACTGTAACTCGCCTAAGCAAGATAACTTCAGCAGCTGCACGATAACCCGTGATT
TTTCAGTCCCTGTTTACATTTCAGGCGGAAACGGAGACATGTCGATGTGCGGCGATAATTGTGTGCGTAT
ATGGTTTGGTCGCCGTGATGACAACTACTGGAGTGACGGGGTATATGATAACGAACTGACATTAAAATTC
CATCCGGATGCAAAATTGGCCTCAGCAAAGATTGTTAACGCGGAGTGGGATGACCACATGCGGGTAACAC
TTGATGGCACGCAGATTTTTGCTCACATAGATGGTGCATATCGAGAAAGTGACTATCCGGCTCCTAAGGG
ATCTTGGGAGTTAAAAAAATCGTGGAAACTCGACAAGGTTTACGATGTGACTGATAAGGTCAGAAAATCG
GTGTATGAGGAGCCTGATCGAGAAGTGACAATGGCATCCAGAGTATGGGTTGGTGGGAAGGGTGAAGGGT
ATTTTGAGGTTGAGCTGACTTTTGAAAATATGAAGCTCGAAGATAAGCACGTCCAGGAACCAGCTGGTTG
TTACGATGCTGTACAAGCTCCGAATACATTCTGCCGTTTCGATCGGTTTAAAGATATGGATGTTGGCACA
AAACGGCTTCCGGAAAGCGTGCTTTCATTGGCAAAGCCTCTGTATGAAGGTGATAAAGGATTTCTTACCT
GGAAGACAAACCTTGAAGGCTACTTTTGTGATCCATTGGCCAAAGACAAAATTTGCTCTTATGACGCTAG
TGGAAAAATTATGAAAGACGCTAATGGAAAGGACCTCTGTTACAACTATGAAGAAATAAAGAGTATGCCT
GATGCATGTAGTGCTTATAAAAATGATGCAGCATGTGTACTCGATAAACAAACATGTGCAGAGGGTTGGT
TCGATGAGGGCACTAACAGTTGCTACATGTATGAACAGAAATACACCTGTGACAGAGGGAAGGATGTAGT
TCGGGAGGTTGAATCTTCTACAAATGCCTGTGTTGGCATGATCCCATGTTCAGGTGGAACATGCGAAACT
GGGCCAAAGGAAGAGAACAACGATTTTGGAAAAGTTGCGGCTTATTCAAACATGGTTCAGTACATGCAGG
GCGAAGCCAAATGCGAAGACCCTAACGATGCCAATTCATGTTCCGTCTTTGAAGGAAAACCTGAATGGTG
TGGTCGTTCAGTAGGCTTTGTAAATGGCCTGGCAAAGACGGACTGCTGCGAAGCACCACAGGGAACCGCA
GGAGCACTTGAAGGTATCATGCTTGCCGGATCTATGATCAGAAACACAAACTGGACCAGAGTTAATGCTC
AGCTAATAAAATGGACCGGCGGTGATACAGGTACATGGGCTTCTATGTCTAATGCGGTCGGAGAGTGGAC
TGCATCAGCTGGTAAAACAGTAGGGCAAATGTGGAACAACGTCACGAGCTCCTTAACGAGCGTATATGAA
AACGTCGCTGGTAATCTAAGCAGGGCAGTTGGGTCTTCCGCAACTTCTGGAGGGGCAGGAGGTGCTGGCC
AGTTGGCACAGGAAACAATGTCCAGCTTCGGTATAGGTCAGCTTAAGCAGATGGCAATGAAGAAAGCCTA
CGAATTGCTACCAGATACAGTTCGTGACTTTGTCTTTAAGAACGTTGCTACTACCGGAGGAGAGGTTGTC
TTCTCGGCTGCGGTTCAAAACTTTATGCTTGCATTAAACGTGATCGGTTGGATTTATACAGCCTATCAGG
TCACTAAAATGCTTTTAGAAATGTTGGTAGCATGCGACCAGAAAGAGATGGAAGCTTCTATTCATAAGAA
TCAAAAATCCTGTTTTACATTAGATACGGAACGATGCGTCAAATATCTGAATGTTGGTTTCACAAAGAAA
TGCGTTAAAAAAGCAACAGACATGTGCTGTTATAATTCCATGTTGTCACGCGTTATTATGCAACAAGCTT
ATCCGCAATTAGGAATAGACCCTGTCGCCTCTAATTGCGTGGGGCTATCAATAAAGCAAATACAGCAACT
GGATTTCGATAAAATTGATCTGACGGAGTGGATTAATGATGCAGTTCAGGTAGGAGAAGTTCCTGATCAA
TATTCAAAATTCTCCGAAGAATCAATTGTGGAAAACTTACCATTCCAGAATGAGAACTATCAACTTCCAT
CAGAACGTACCAAGGAAGCAATGGGCGGTGAAGAAAATATGATAAAGGCCAGACAAGAAAATGCTCAGGC
TATAAAAGAGGAAAATGTAGATTGTAGCTATTTACCTCGACCGGCCATATGTGAGGTAGGTTCAACTACG
CTGGATCCGGTTACGGGCAAGCAGTTGCCGAAATATTGA
 Primer design