SecReT4
Protein ID: 38347859
T4SS name [ID]Tra_F [577]
Gene symboltrhI
Locus tagSMR0031
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]36555..38339 [+]
Productputative DNA helicase
Component typeTraI_F
UniProt IDQ6MY08
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam UvrD_C [PF13361], Evalue: 1.8e-40, Aligned region: 254..564
UvrD-helicase [PF00580], Evalue: 5.8e-29, Aligned region: 5..91
UvrD-helicase [PF00580], Evalue: 5.8e-29, Aligned region: 145..248
UvrD_C_2 [PF13538], Evalue: 1.2e-10, Aligned region: 496..562
AAA_19 [PF13245], Evalue: 1.6e-07, Aligned region: 12..86
PhoH [PF02562], Evalue: 4.4e-05, Aligned region: 5..246
Protein Sequence: 594 a.a.     [Download]
>gi|38347859|ref|NP_941108.1| putative DNA helicase [Serratia marcescens]
MGKPTEEQRPVIENASANNMVIAAPGSGKSFTMIEAVISILKKYPYARIGMVTFTRAATNALAAKLQKRL
SKKDLDRVLVDTFHGLVKKQLDMIRWPGKMLIGPAQRSVIHRALKESGVTMKFAEAEFVIDAIGREMDTD
VISVRHNRQQIHLFNTYQALCQKDHVADLNALSKFVVGQMHSGKMRTLDLTHLIVDEVQDTDSIQFSWIA
LHTRAGVYTSIVGDDDQAIYSFRSSGGVKIFQQFEKHFRPNIFYLNTCFRCEPEILEVAGALIGKNVYRY
AKELRSAKKGGGKVTFRSYVDMEEQIQGILSLINQDPHGWAILSRNNAHLDELESLIEQPVIRYGGKSFW
DEKETSDVLSLMAFFRQSNDPRLMKRVLALFGEQESVLDEVALSMRGRKVTFGDLAIPEDSSLETKTLHS
NFVRFTQESSDKVEIAKRFANLTKWMESSSIKMRSNKGTATLTKIALDTCKQWAEKTGWMNMINRAAAMS
LGPRKKDEEYSPEKVVLSTLHGSKGLEWNKVIIMSCNADQIPSKRSVGEEAIEEERRLLYVGFTRAEKQL
FVMWYGDPSFFLRECSEEKIKEAANIRISPLYTE
 
Nucleotide Sequence: 1785 bp     [Download]
>gi|38347830|ref|NC_005211.1|:36555-38339 Serratia marcescens plasmid R478, complete sequence
ATGGGTAAGCCAACAGAAGAGCAAAGACCTGTTATCGAGAATGCTAGCGCAAACAATATGGTGATAGCAG
CGCCTGGATCAGGCAAATCGTTCACCATGATAGAAGCGGTTATATCGATTCTCAAAAAGTATCCATATGC
AAGAATCGGGATGGTGACCTTTACTCGCGCTGCAACAAACGCACTTGCAGCAAAGTTACAAAAGCGATTG
AGCAAGAAGGATCTTGACCGGGTGCTGGTGGATACTTTTCACGGACTCGTTAAGAAGCAACTGGACATGA
TTCGCTGGCCGGGAAAGATGTTGATAGGGCCAGCACAGAGATCTGTCATTCACCGGGCTTTGAAAGAATC
CGGTGTAACGATGAAGTTTGCTGAAGCTGAATTCGTTATTGATGCTATCGGCAGAGAAATGGATACGGAT
GTGATTTCAGTTCGGCATAACAGACAACAGATCCATTTGTTTAATACCTATCAGGCGTTATGCCAGAAAG
ACCATGTGGCGGACCTCAATGCTCTTTCAAAATTTGTTGTCGGTCAAATGCATTCGGGAAAAATGCGCAC
GTTAGATTTGACACATTTGATAGTAGACGAAGTTCAGGATACTGACTCTATACAATTCTCATGGATAGCA
TTGCATACAAGAGCTGGAGTCTATACGAGTATAGTTGGAGACGATGATCAGGCCATCTACTCCTTCAGAT
CCTCAGGAGGAGTCAAAATATTTCAACAGTTTGAAAAACACTTCAGACCTAACATATTTTACTTAAACAC
ATGCTTTAGGTGTGAACCTGAAATTTTAGAGGTGGCCGGAGCACTGATAGGAAAGAATGTTTACCGTTAT
GCCAAAGAGTTACGCTCGGCAAAAAAGGGAGGGGGAAAGGTCACTTTTCGTTCATATGTAGATATGGAGG
AACAGATACAGGGTATTTTAAGCCTTATAAATCAGGATCCACATGGATGGGCAATTCTAAGCCGCAATAA
TGCTCACTTGGATGAGCTAGAAAGTTTGATCGAACAGCCAGTAATTCGTTACGGAGGTAAATCATTCTGG
GATGAAAAAGAAACAAGCGATGTGTTAAGCCTTATGGCCTTTTTCCGACAATCAAATGATCCTCGCTTAA
TGAAGAGAGTATTGGCATTGTTTGGAGAACAGGAATCAGTTTTGGATGAAGTGGCATTGAGTATGAGAGG
AAGAAAAGTTACTTTTGGCGACCTTGCCATCCCGGAGGACAGTTCTCTCGAAACAAAAACATTACATTCA
AACTTCGTGCGCTTTACCCAGGAAAGTTCTGATAAAGTTGAGATAGCAAAACGTTTCGCCAACCTTACGA
AATGGATGGAATCGTCGTCAATCAAGATGAGGAGTAATAAAGGTACAGCAACCTTAACAAAAATTGCTTT
AGACACTTGTAAACAGTGGGCAGAAAAGACTGGTTGGATGAATATGATAAATCGTGCTGCTGCAATGTCA
TTAGGCCCTAGGAAGAAGGACGAGGAATACAGCCCAGAGAAAGTAGTCCTATCAACCTTGCATGGTTCAA
AGGGTCTTGAGTGGAATAAAGTAATAATAATGAGTTGTAATGCGGATCAGATACCAAGTAAAAGATCAGT
TGGGGAGGAGGCAATAGAAGAAGAAAGACGTTTGCTTTATGTTGGATTTACGCGTGCAGAAAAGCAACTT
TTTGTAATGTGGTATGGTGATCCTTCTTTCTTTTTAAGAGAATGCAGTGAAGAAAAGATAAAAGAAGCAG
CTAATATTCGAATTTCTCCACTTTATACAGAATAA
 Primer design