SecReT4
Protein ID: 38348019
T4SS name [ID]Tra_F [577]
Gene symbol-
Locus tagSMR0199
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]179083..179622 [+]
Productputative pilin biogenesis protein
Component typeOrf169_F
UniProt IDQ6MXJ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 179 a.a.     [Download]
>gi|38348019|ref|NP_941268.1| putative pilin biogenesis protein [Serratia marcescens]
MFTPPADDVKPIPVPDEIYTQCITDAARYFGIDAELVFTLFDNEGGKVGTFSRNTNGTYDIGPMQINSSN
LPEIKKHFPTVTWRVLAYDACASFWVGTWWLYRKIVDRKGNVFEGIADYNSKTPKVRAKYIFNFMVKYNR
RIQQRNGMGELYQWTQQPPRYNGHIAKNVPEQNPTPVVK
 
Nucleotide Sequence: 540 bp     [Download]
>gi|38347830|ref|NC_005211.1|:179083-179622 Serratia marcescens plasmid R478, complete sequence
GTGTTTACACCACCAGCAGATGATGTGAAACCTATTCCCGTTCCTGATGAGATTTACACTCAGTGCATTA
CGGATGCCGCCCGCTACTTCGGAATTGATGCTGAACTGGTTTTTACGTTGTTTGACAATGAAGGCGGTAA
GGTTGGTACTTTCAGCAGGAATACTAACGGCACTTATGATATTGGCCCAATGCAGATCAACTCATCCAAT
CTACCTGAAATAAAAAAGCATTTCCCGACGGTAACGTGGCGGGTTCTGGCTTACGATGCTTGCGCAAGTT
TCTGGGTTGGAACATGGTGGCTCTATAGAAAAATTGTTGATCGCAAGGGCAATGTGTTTGAAGGGATTGC
AGATTACAACAGCAAAACCCCAAAGGTACGTGCAAAGTACATATTTAACTTCATGGTAAAGTACAATCGC
CGGATCCAGCAGCGTAACGGGATGGGTGAGCTTTATCAATGGACCCAGCAACCTCCTCGATACAATGGCC
ATATAGCTAAAAATGTCCCGGAGCAAAACCCGACTCCTGTTGTTAAATAA
 Primer design