SecReT4
Protein ID: 38348023
T4SS name [ID]Tra_F [577]
Gene symboltrhG
Locus tagSMR0203
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]182086..186036 [-]
Productputative inner membrane protein
Component typeTraG_F
UniProt IDQ6MXJ5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 9.1e-77, Aligned region: 4..497
Protein Sequence: 1316 a.a.     [Download]
>gi|38348023|ref|NP_941272.1| putative inner membrane protein [Serratia marcescens]
MDYNIYTLGDIDFVWSAFTGIALIFSQYTGVKEFLTTAAVVAGVSLFYKTWLWLQAPTKNELPFFSWFLG
LILFMMAMVRVDVTIESVKSGEVRNVDGIPIFIAAMATVTTNLSQGLLKDYKTAFDPLSPVDLSATTLDD
DITLGPMIRFVKFLQWGGDSQGYCSAFPEPASGLGPMNVCATVQSLAYNCLKATQNSSANIAGKETIFND
IFSANLADSMDRINQAMKGALKNASASIVGANGSKSGTCDEVWSTVKQVTSTAEARQTISLIGQTNGILT
PDEANGAPTGASFTDVMASANGMYGKAIGSYDATLNLFIMNELRNGASKYKTPLGLASDMQLFEASLKRT
NTMASQGQLWLQLSGAAIAFLEMFAYMVAPFALLMLLALGGNGVAAAAKYLQLILFVNMWPLTAVMVNAY
VKKVATADLDTWSTLNSQNNAVTWMGLPGLAETYSSYLSVASALYALIPVLTLFLMTQSIHPMMNAVKGV
TPDAPVDTGHVTPKVWDGPNSGKSSFGDVTRTALTSTGQGYSDGGAVDSSNFRLGMWNAGSSIANSQGQG
SAVTSSVMSAASNSFQAGYSQMSEIGRSGQSSQQFSTNLQTMKQISDKIGASVAEGIATKHGVSASQMAS
IASNVILNAGLNGGVGTGNGAGLKAAVAGQLSSGASKTNTGSDSLSNDLSKAITNQLSQDSALTDQFSKA
ASQVSSDQISNTNAFKEASSKMNQATQTMAQNISTSVSTNASSNSGMSLDSKQSINLDRFSDSIRNKNFS
DDDVRNFARKNGLDENAFMEKFNSYNDTFKASNQLGSQLQRTDALVAATRDFSEQKIAIDTARGETAESN
KQDLRETSSLLKSLVSDFGGNAQQLLPITNQLDRISGDGSGINTITQAQDRTPDSVNTSGVMSASRVGEL
GGSVDSQAKLGLSSNAQDATQRVPGKSEAGFTPYNLDNAGKGDIQGIHNNNVGRTYSDEERNVLNSLEKN
GPVLNNQGVEKVVNSGQDVRNAEGTFNDLEKVGGRVVGDGMDQRATALNSMYQSGQVRGLSNNTDNYFSR
VANNPNLSRDDKRAELAQQAVFTYGASTMATGAEREQLKADTQKILNELGNYNVNWSMNDVKSIHSSFNT
HNRADGSLESVVRANLGEGGSGGGLVGNRTQTVTDRLVGEKIEANTERGAISGALLGGQQFVSDTLTSVG
AKPVNEMLTGAGILQTQTSIANDASNPANMPDSLQGKVLNHMQMSDGVAAVSDRYQSISSDGVSTYANAA
QNSERAIRQQLTDDPRFGPQKADEFIQYMKSELSNTNEPYQSRVDKADQWLNENKK
 
Nucleotide Sequence: 3951 bp     [Download]
>gi|38347830|ref|NC_005211.1|:c186036-182086 Serratia marcescens plasmid R478, complete sequence
ATGGATTACAACATATATACCCTGGGTGATATTGATTTTGTCTGGTCGGCTTTTACCGGTATTGCCCTGA
TCTTTTCTCAATATACTGGTGTAAAAGAGTTCCTGACCACGGCCGCCGTTGTAGCAGGTGTGAGCCTATT
CTATAAAACGTGGCTATGGCTTCAGGCTCCGACCAAAAATGAATTACCGTTTTTCTCCTGGTTTTTGGGG
TTGATCCTTTTCATGATGGCAATGGTTCGAGTGGATGTAACTATTGAATCTGTAAAGTCGGGAGAGGTCA
GAAACGTCGACGGAATTCCAATTTTTATTGCTGCGATGGCAACCGTCACCACTAACTTAAGCCAGGGTTT
GCTGAAGGATTATAAAACAGCGTTTGATCCGCTTTCTCCGGTGGACCTGTCTGCAACAACTCTGGACGAT
GACATCACCCTCGGTCCGATGATCCGATTCGTGAAGTTTTTGCAATGGGGCGGCGATAGCCAGGGCTACT
GTTCCGCATTTCCTGAACCGGCCAGCGGGCTAGGGCCAATGAACGTATGTGCTACCGTTCAGTCTCTTGC
ATACAACTGCCTGAAGGCTACCCAAAACTCAAGCGCAAATATTGCCGGTAAAGAAACTATTTTTAACGAT
ATTTTCTCAGCTAATCTGGCAGATAGCATGGACCGGATTAATCAGGCGATGAAAGGCGCACTGAAGAATG
CCTCTGCCAGTATTGTTGGCGCTAACGGTTCAAAATCTGGTACGTGTGATGAGGTCTGGTCAACTGTGAA
ACAGGTTACCAGTACAGCTGAAGCTCGCCAGACTATTTCCCTTATAGGACAGACAAACGGCATCCTTACT
CCAGACGAAGCAAATGGTGCACCTACCGGCGCAAGCTTTACTGATGTTATGGCGTCAGCAAATGGTATGT
ACGGTAAGGCTATTGGTTCGTATGACGCCACCCTGAACCTGTTCATTATGAATGAGCTCAGAAATGGCGC
AAGCAAATATAAGACCCCACTCGGTCTGGCTTCCGATATGCAGTTGTTTGAGGCTTCTCTGAAGCGAACC
AACACAATGGCTTCACAGGGCCAGTTGTGGTTACAACTGTCGGGAGCAGCAATCGCATTCCTTGAAATGT
TTGCTTATATGGTTGCTCCATTTGCTTTGCTTATGCTGCTGGCGTTAGGTGGTAATGGTGTTGCCGCTGC
GGCGAAATATTTGCAACTTATCCTCTTCGTGAATATGTGGCCGCTTACGGCAGTAATGGTCAACGCGTAT
GTGAAGAAAGTCGCGACGGCCGACTTGGATACCTGGAGCACCCTCAACAGCCAGAATAATGCCGTCACGT
GGATGGGACTCCCAGGGCTTGCGGAAACATACAGTTCATACCTGTCTGTTGCTTCCGCCCTCTATGCTCT
GATTCCGGTACTCACATTATTCCTGATGACACAGTCGATTCACCCGATGATGAATGCGGTTAAGGGAGTG
ACCCCCGATGCGCCGGTGGATACTGGTCATGTAACGCCCAAAGTATGGGATGGCCCTAACAGCGGTAAAT
CTTCATTTGGTGACGTGACACGAACCGCCTTAACCAGTACCGGTCAGGGATACAGCGATGGCGGCGCAGT
TGATTCAAGTAATTTCCGTCTTGGAATGTGGAATGCTGGTTCAAGTATCGCTAACAGCCAGGGACAAGGA
TCAGCTGTAACCTCATCAGTTATGAGTGCGGCAAGTAATTCATTCCAGGCTGGTTACAGTCAGATGAGCG
AAATTGGAAGGTCAGGACAGTCGAGCCAGCAGTTCTCAACCAACCTGCAAACAATGAAGCAGATCTCGGA
TAAGATTGGTGCCTCTGTAGCAGAAGGTATTGCAACGAAACATGGGGTGAGTGCGTCTCAGATGGCCAGC
ATTGCTTCAAATGTTATTCTCAACGCTGGGCTTAATGGAGGTGTTGGAACTGGCAATGGAGCCGGGCTGA
AAGCGGCTGTAGCAGGGCAATTGAGTAGCGGTGCATCTAAGACCAATACAGGCAGTGACTCGCTTTCAAA
TGACCTTTCAAAAGCAATCACGAATCAGCTTAGCCAGGATTCTGCGTTAACTGACCAGTTCAGTAAAGCG
GCGTCTCAGGTAAGCAGCGATCAGATATCCAATACTAATGCGTTTAAAGAAGCATCGTCGAAAATGAACC
AGGCGACACAGACGATGGCGCAAAATATTTCTACATCGGTTTCGACTAACGCAAGCTCCAATAGTGGAAT
GAGCCTTGATTCTAAACAAAGCATTAACCTGGACAGGTTCTCCGATTCTATTCGCAACAAAAACTTCAGT
GATGATGATGTAAGGAATTTTGCTCGTAAGAATGGGCTGGATGAGAATGCGTTTATGGAGAAATTCAACT
CCTATAACGATACCTTCAAGGCCAGTAATCAGCTTGGATCGCAGCTTCAACGTACTGACGCGCTTGTGGC
TGCAACACGAGATTTCAGTGAGCAAAAAATTGCGATTGATACCGCCCGGGGAGAGACGGCCGAAAGTAAT
AAACAGGATCTCCGTGAAACCTCCAGCCTGCTTAAAAGTCTGGTTTCCGACTTCGGTGGTAATGCACAGC
AGCTGCTACCTATCACCAATCAGCTCGACAGAATTTCAGGTGACGGGTCAGGAATTAATACTATCACTCA
GGCACAGGATAGAACTCCTGACAGCGTAAATACGTCTGGCGTGATGAGTGCGTCACGCGTAGGGGAACTG
GGTGGAAGTGTAGATTCGCAGGCTAAACTCGGTCTTTCCTCCAACGCTCAGGACGCGACACAGCGTGTCC
CTGGAAAAAGTGAAGCTGGCTTTACTCCGTATAACCTTGATAACGCGGGCAAAGGCGATATTCAGGGAAT
ACATAACAACAACGTGGGCCGCACTTATTCTGATGAAGAAAGGAATGTGCTTAATTCTCTCGAAAAGAAT
GGACCTGTACTGAATAATCAGGGTGTAGAGAAAGTCGTCAATTCGGGTCAGGATGTCAGAAATGCAGAAG
GCACATTTAACGATCTGGAAAAGGTTGGAGGTCGGGTGGTTGGTGATGGAATGGATCAACGAGCCACTGC
TTTGAACAGTATGTATCAGAGCGGGCAAGTTCGTGGCTTATCTAATAACACTGATAACTACTTTAGTCGT
GTTGCCAACAACCCGAACTTAAGCCGGGACGATAAGCGAGCTGAATTGGCACAGCAAGCTGTCTTTACCT
ATGGTGCCAGCACCATGGCTACCGGTGCCGAAAGAGAGCAGCTCAAAGCGGATACCCAGAAGATCCTTAA
TGAACTGGGTAACTATAACGTTAACTGGAGTATGAATGACGTTAAGAGCATCCATAGCAGTTTCAACACT
CATAACAGAGCTGATGGTTCACTTGAGTCAGTCGTACGGGCAAACCTGGGAGAAGGTGGGTCGGGCGGTG
GTCTCGTTGGTAACCGCACTCAGACCGTCACAGATCGCTTGGTTGGGGAAAAGATAGAGGCCAACACTGA
GCGGGGCGCGATTTCTGGTGCGCTACTCGGGGGCCAGCAATTTGTTTCGGATACGCTAACCAGCGTTGGG
GCGAAACCGGTAAATGAGATGCTTACGGGAGCGGGCATCCTTCAAACCCAGACATCGATAGCAAATGATG
CCTCTAACCCTGCAAATATGCCTGATTCTCTCCAGGGTAAAGTCCTTAATCACATGCAGATGTCTGATGG
CGTCGCAGCTGTAAGTGACCGGTATCAGAGTATTAGCAGCGACGGCGTTTCGACTTATGCGAATGCAGCG
CAGAACTCTGAAAGGGCTATCCGGCAGCAATTGACGGATGACCCACGCTTTGGGCCTCAGAAAGCAGATG
AATTCATTCAGTACATGAAGTCAGAGCTGAGCAACACAAATGAGCCTTACCAGTCACGTGTCGATAAAGC
GGATCAGTGGCTTAATGAAAATAAAAAATAA
 Primer design