SecReT4
Protein ID: 38348024
T4SS name [ID]Tra_F [577]
Gene symboltrhH
Locus tagSMR0204
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]186045..187460 [-]
Productputative pilus assembly protein
Component typeTraH_F
UniProt IDQ6MXJ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 4.8e-87, Aligned region: 33..398
Protein Sequence: 471 a.a.     [Download]
>gi|38348024|ref|NP_941273.1| putative pilus assembly protein [Serratia marcescens]
MRSNAVFNFKKLLLSLSVCAAILAPTANADNAMRNIFNGMMTSTSPATFSTATRTGIVGGSMSYRTTNVN
TNLVSMSFPKASVGCNGIDVFLGSFSMINGDQLVQVARGIAQGAAIYAFNVAVSAICADCAATINDIQNK
LQALNKFAKDSCNATYSFLSENVGTPSQFANSVSSGPASILGSINGLIPDFGSSMTKSPEAVTSQVKAKD
PEEFAEKFSGNLFYMSFMDIDKGTMNIGGVTELSGYKLAEQLMSLVGTVIINWDSKGEKAGMEVRPSTMT
VTDYIMGPPAGGSIKMLKCSPAPDPSSPRKAQCLVMSEVNDGGFKGLKDTISDLLLNVQKKIINDVRVSD
DELRIISYIGIPTIIDSLQTFEAPEGYAYIQDISTIAATSLVINMLRQVEAKISTMSIPSESLSGKRDDL
NRLTDNLSKQVKAAYELSHSQVGTSSDVISTWDNRRLQRKAFTESIRGTRN
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|38347830|ref|NC_005211.1|:c187460-186045 Serratia marcescens plasmid R478, complete sequence
ATGCGCAGTAATGCCGTTTTCAACTTCAAAAAGTTACTTTTGTCTCTTTCTGTTTGTGCTGCAATTTTAG
CCCCGACTGCAAATGCAGACAACGCAATGCGTAACATTTTCAATGGCATGATGACGTCTACCAGCCCGGC
CACCTTTTCCACAGCAACCCGTACAGGCATAGTTGGCGGGTCAATGTCTTACCGAACAACAAACGTTAAT
ACCAACCTTGTTTCCATGTCGTTTCCAAAAGCTTCTGTCGGTTGTAACGGTATTGACGTTTTTCTTGGGT
CCTTCAGCATGATCAACGGGGACCAGCTTGTGCAGGTGGCCCGTGGTATTGCCCAGGGTGCGGCTATCTA
TGCTTTTAACGTTGCTGTTTCAGCTATTTGTGCTGACTGTGCTGCAACGATTAATGACATCCAAAACAAA
CTGCAAGCGCTAAATAAATTTGCGAAAGATTCATGCAATGCAACTTACTCTTTCCTTTCTGAAAACGTGG
GTACGCCAAGCCAGTTCGCTAACTCAGTTAGCTCTGGACCAGCCTCAATTCTGGGATCGATTAATGGTCT
TATTCCTGATTTTGGCTCATCGATGACAAAGTCACCTGAAGCTGTCACTTCTCAGGTTAAAGCAAAGGAT
CCCGAAGAGTTCGCTGAAAAATTCAGTGGTAACCTCTTCTATATGTCGTTCATGGATATTGATAAGGGAA
CGATGAACATCGGAGGGGTAACGGAGTTATCCGGTTATAAACTGGCAGAACAACTTATGTCTCTCGTAGG
TACTGTCATTATCAACTGGGATAGCAAAGGCGAAAAAGCGGGAATGGAAGTCCGCCCGTCTACCATGACT
GTCACGGATTACATCATGGGGCCACCAGCTGGCGGATCAATTAAAATGCTCAAGTGTTCTCCGGCACCAG
ATCCATCATCCCCACGAAAGGCTCAGTGCCTTGTCATGTCAGAAGTTAATGACGGTGGTTTTAAGGGATT
GAAGGATACCATTTCTGATCTTCTTTTAAACGTACAGAAAAAAATCATCAACGACGTTCGTGTTTCAGAT
GATGAATTACGCATTATCTCCTATATCGGCATCCCGACCATTATCGACTCTTTGCAAACATTCGAAGCAC
CGGAAGGGTACGCATACATTCAGGACATCAGCACTATTGCTGCGACGAGCCTCGTAATCAACATGTTGCG
CCAGGTTGAGGCCAAAATTTCAACCATGAGCATACCGAGTGAGTCGCTGTCGGGTAAAAGGGATGATCTC
AACCGATTAACAGACAATCTCTCAAAACAGGTTAAAGCCGCCTATGAGCTATCGCACAGCCAGGTCGGTA
CCAGCTCGGACGTCATTTCAACCTGGGATAACCGTCGCCTGCAACGGAAGGCTTTCACTGAAAGTATTCG
TGGCACACGTAACTGA
 Primer design