SecReT4
Protein ID: 38348025
T4SS name [ID]Tra_F [577]
Gene symboltrhF
Locus tagSMR0205
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]187450..188496 [-]
Producthypothetical protein
Component typeTraF_F
UniProt IDQ6MXJ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.7e-50, Aligned region: 45..267
Thioredoxin_2 [PF13098], Evalue: 2.6e-07, Aligned region: 174..265
Protein Sequence: 348 a.a.     [Download]
>gi|38348025|ref|NP_941274.1| hypothetical protein SMR0205 [Serratia marcescens]
MTRIALAPSKMVLLMSLVITGAHASPEQPLIKDTPFVSGQAYKKGFFWYDDPAKKSEAEEEEVLPPTGAA
SSPSKEEMVDLNSKWLKENMPRLLTQAMDNPTAENLSRYYTAQRLMLDISTRFSDKSKDYFLKNPMMSEK
RRQPVEKVALDAHRTVVEKNQQTVMKDIFTKSGLFFFFQSTCQFCHEESQILQFMQNYYSVDILPISMDG
RPLHNGLFQDFNIPNAQIIDQFKIREVPTIFLVSKDGTSAQRISEGMISADELKNTIILAAKGMNLIDDA
SFQSTLDIKRQYTIGDDGVITVNKSEMESDPFLLQKIMDQKLEGYDMPTADPVNYLNAGGSFGGTYAQ
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|38347830|ref|NC_005211.1|:c188496-187450 Serratia marcescens plasmid R478, complete sequence
ATGACTCGTATTGCATTAGCGCCTTCAAAGATGGTTTTGCTTATGTCTTTGGTAATTACTGGTGCCCACG
CCAGCCCTGAGCAACCCCTAATAAAAGATACGCCCTTTGTATCTGGCCAGGCTTATAAGAAGGGTTTCTT
CTGGTATGACGATCCTGCTAAAAAAAGCGAAGCTGAAGAAGAAGAGGTTTTGCCACCAACCGGTGCTGCT
AGCTCGCCTTCAAAAGAGGAAATGGTAGATTTAAATTCAAAATGGCTAAAAGAGAATATGCCTCGACTGT
TAACGCAGGCAATGGATAACCCTACCGCAGAAAATCTATCACGTTATTACACGGCGCAAAGGTTAATGCT
GGATATCAGTACGCGTTTTTCTGACAAATCAAAAGATTATTTTCTTAAAAACCCGATGATGTCTGAAAAA
CGCAGGCAACCAGTGGAAAAGGTGGCACTGGATGCTCACCGCACTGTTGTTGAAAAAAATCAGCAAACGG
TAATGAAAGATATCTTTACTAAGTCAGGTTTATTTTTCTTTTTCCAGAGTACTTGCCAGTTTTGCCACGA
AGAAAGCCAAATACTTCAATTTATGCAGAACTATTATTCGGTAGATATTCTTCCAATCAGTATGGATGGA
AGGCCATTGCATAATGGCCTTTTTCAGGATTTTAACATCCCCAACGCACAAATTATTGATCAATTTAAAA
TTCGAGAGGTACCTACAATTTTCCTGGTTTCAAAGGATGGGACATCAGCTCAGCGCATTAGTGAAGGCAT
GATCTCCGCTGATGAATTAAAGAACACTATTATACTTGCCGCGAAGGGCATGAATCTGATCGATGACGCT
TCGTTCCAGTCAACTCTAGATATTAAAAGGCAATATACCATCGGCGATGATGGCGTTATTACCGTTAATA
AATCCGAAATGGAATCAGACCCATTCCTACTTCAAAAAATAATGGACCAAAAACTCGAAGGCTATGACAT
GCCTACGGCCGATCCGGTCAATTATCTCAATGCTGGCGGCAGTTTTGGAGGCACTTATGCGCAGTAA
 Primer design