SecReT4
Protein ID: 38348032
T4SS name [ID]Tra_F [577]
Gene symboltraG
Locus tagSMR0212
StrainSerratia marcescens plasmid R478 (NC_005211)
Repliconplasmid R478 [GenBank: NC_005211] [Browse all T4SS(s) in this replicon]
Location [Strand]195537..197621 [+]
Productmembrane protein
Component typeTraD_F
UniProt IDQ6MXI6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 6e-17, Aligned region: 199..582
TrwB_AAD_bind [PF10412], Evalue: 6.5e-15, Aligned region: 412..604
TraG-D_C [PF12696], Evalue: 9.8e-10, Aligned region: 505..617
Protein Sequence: 694 a.a.     [Download]
>gi|38348032|ref|NP_941281.1| membrane protein [Serratia marcescens]
MSDSKRTNLHAQENFYRPILEYRSASILLICSVSMLYMGLSSDGLDIAPIVLFTSILLFLLCLYRCKTAA
PFLMAHWRVFKRHFMFVSLDSLRVINKSNFFSNERKYRQLVQDYQNKNKDIPERKSYFCDGFEWGPEHAD
RAYQIANLSSDKREIELPFVFNPIKRHFDAMARKMGGSNAIFAVERREPIFVTEDNWFGHTLITGNVGTG
KTVLQRLLSISMLHLGHVVVVIDPKNDAEWRESLMEEAKTLGLPFYKFHPGQPASSVCIDVCNTYTNVSD
LTSRLLSLVTVPGEVNPFVQYAKALVSNVISGLSYIEKKPSIYLIHKNMKSHMSIVNLTVKVMESCYARY
YGYDVWTEKVKYVANDTLPVRFKRLAEWFTAHFMNYEGSEQIDWLDTVSQLIDYSMSDPEHMAKMTAGIM
PVFDMLIEKPLNELLSPNPNSVSSREIVTSEGMFSTGGVLYISLDGLSNPDTAAAISQLIMSDLTSCAGS
RYNAQDGDMSANSRISIFVDEAHSAINNPMINLLAQGRAAKIALFICTQTISDFIAAASVETANRITGLC
NNYISLRVNDTPTQTLVVENFGKSAISTNMVTYTTGSETSLPHNNFSGSISERKQTTLEESIPKDLLGQV
PMFHIVARLQDGRKVVGQIPIAVAEKQMKPNTTLSEMLFKKAGKVTLRQNLDIKNLNKFLRKLH
 
Nucleotide Sequence: 2085 bp     [Download]
>gi|38347830|ref|NC_005211.1|:195537-197621 Serratia marcescens plasmid R478, complete sequence
ATGTCAGATTCGAAGAGGACTAACCTCCATGCACAAGAGAATTTTTATCGGCCTATTCTTGAGTATCGTA
GTGCCTCAATACTTTTGATTTGTTCGGTTTCTATGCTTTATATGGGACTTTCTTCAGACGGACTGGACAT
CGCCCCAATAGTTCTGTTCACCTCAATATTGCTTTTTTTGCTGTGCCTTTATCGTTGCAAAACAGCAGCG
CCATTTTTGATGGCTCATTGGCGTGTATTCAAGCGACATTTCATGTTCGTTAGTCTTGATTCACTGCGTG
TAATTAACAAAAGTAACTTTTTCTCCAATGAGCGAAAGTATCGTCAACTGGTTCAGGATTATCAAAATAA
AAATAAGGATATACCCGAGCGAAAGTCCTATTTTTGTGATGGGTTTGAGTGGGGTCCGGAACATGCGGAT
CGGGCATATCAAATAGCTAACCTCTCCAGTGATAAACGTGAGATCGAGTTGCCATTCGTCTTCAACCCAA
TTAAGAGACATTTTGACGCAATGGCTCGTAAGATGGGCGGCAGCAATGCAATTTTTGCTGTGGAACGTAG
GGAACCCATATTTGTAACTGAAGACAATTGGTTTGGTCATACTCTGATAACCGGAAACGTGGGTACCGGG
AAAACGGTGCTACAGCGTTTACTAAGCATTAGCATGCTTCATCTTGGTCATGTTGTTGTTGTCATAGATC
CAAAGAACGATGCAGAGTGGCGAGAATCTCTAATGGAAGAGGCTAAGACCCTCGGTCTTCCTTTCTATAA
ATTTCATCCTGGCCAGCCAGCATCTTCGGTCTGTATTGATGTCTGCAACACCTATACTAATGTTTCTGAC
CTAACATCTCGTCTTTTGAGCTTGGTGACAGTTCCCGGTGAGGTTAACCCATTCGTTCAGTATGCCAAGG
CTCTCGTTTCCAATGTGATTTCCGGGCTTTCTTACATAGAGAAAAAGCCTTCTATTTATCTGATTCACAA
GAACATGAAAAGCCACATGTCTATTGTGAATCTTACAGTCAAGGTAATGGAGTCATGTTACGCGAGATAT
TATGGTTACGATGTCTGGACCGAAAAAGTTAAGTACGTCGCTAACGATACCTTGCCGGTACGTTTCAAGC
GTCTCGCTGAATGGTTTACGGCTCATTTCATGAATTACGAGGGGTCCGAACAAATAGACTGGTTAGATAC
TGTTTCCCAGCTTATTGATTACTCAATGTCCGACCCAGAGCATATGGCTAAAATGACCGCAGGTATTATG
CCTGTTTTCGATATGCTCATTGAAAAACCTTTAAATGAGCTTTTATCTCCTAACCCGAACTCAGTATCAT
CAAGAGAAATTGTAACAAGCGAAGGGATGTTCAGCACTGGCGGGGTGCTATACATTTCGCTTGATGGCCT
TTCAAACCCCGATACAGCAGCTGCTATTTCTCAATTAATAATGTCAGATCTGACCTCCTGTGCCGGTAGT
CGCTACAACGCTCAAGATGGTGATATGTCAGCTAATTCCAGGATAAGTATTTTTGTTGATGAGGCACACT
CAGCCATTAACAACCCTATGATTAACCTTCTGGCGCAGGGTCGTGCAGCGAAAATTGCACTGTTTATTTG
CACCCAAACCATCTCCGACTTTATTGCTGCGGCAAGTGTTGAAACTGCCAATCGAATTACGGGGCTCTGC
AACAATTATATAAGCTTGCGAGTCAACGATACTCCTACTCAGACGCTTGTTGTAGAGAACTTTGGTAAGA
GTGCGATAAGCACAAATATGGTCACTTATACGACCGGTTCAGAAACATCTTTGCCGCATAATAACTTCTC
AGGTTCAATCTCAGAAAGAAAGCAGACAACTTTAGAAGAGAGTATTCCAAAGGATCTCTTGGGTCAGGTC
CCTATGTTTCACATAGTTGCCAGGCTTCAAGATGGCAGGAAGGTTGTAGGCCAAATCCCTATTGCTGTTG
CTGAGAAACAAATGAAGCCAAACACAACTCTGTCGGAAATGCTTTTCAAGAAGGCCGGAAAAGTTACTTT
GCGTCAAAATCTCGATATCAAAAATCTTAATAAATTTCTAAGGAAGTTGCATTGA
 Primer design