SecReT4
Protein ID: 38638018
T4SS name [ID]Trb [769]
Gene symboltrbG
Locus tagPHG357
StrainRalstonia eutropha H16
Repliconplasmid megaplasmid pHG1 [GenBank: NC_005241] [Browse all T4SS(s) in this replicon]
Location [Strand]371118..372032 [-]
Productcannel-forming protein
Component typeTrbG
UniProt IDQ7WWY5
KEGG IDreh:PHG357
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.9e-51, Aligned region: 73..295
Protein Sequence: 304 a.a.     [Download]
>gi|38638018|ref|NP_942992.1| cannel-forming protein [Ralstonia eutropha H16]
MPMEARTPSRLLPLAIALGLALLLSIPDGNAAEKNGRRLGAGVAGLGIGDLSDAMNPGNPFNGGVDPIAL
PGDSRLVVFTYSRDQIFRVLSAPLKVTTIEFPDDEQIVGDPAWGENVRWDYDTDGANHLYVKPQAAGLVN
TLSVNTNKRSYEFTLVSSPLGGIFYQKVRFRIPTSISAKVKARNDARDEQGEDARSAGAEARNPDAVGVS
PDQLNFEYSISGTASFKPETAFDDGKALWLRLPAAALQSWPVALVKDGSDFVVVNQIRRGGYLVVQRLAD
TIVLRSGDDEIKIERGRRRVLGLF
 
Nucleotide Sequence: 915 bp     [Download]
>gi|38637668|ref|NC_005241.1|:c372032-371118 Ralstonia eutropha H16 megaplasmid pHG1, complete sequence
ATGCCCATGGAAGCGCGCACCCCCTCCCGACTTCTCCCGCTGGCCATCGCCCTTGGCCTGGCACTGTTGC
TCTCCATCCCCGATGGCAACGCGGCGGAAAAGAATGGGCGACGCCTCGGCGCAGGCGTCGCCGGCCTTGG
CATCGGCGATCTGAGCGATGCCATGAACCCGGGCAACCCGTTCAACGGCGGTGTCGATCCGATCGCGTTG
CCGGGTGATTCACGCCTCGTCGTATTCACGTACAGCCGCGACCAGATCTTCCGCGTGCTGAGCGCGCCTC
TGAAAGTCACAACGATCGAGTTCCCGGACGATGAGCAGATCGTTGGCGACCCGGCATGGGGCGAGAACGT
GCGCTGGGATTACGACACGGATGGCGCCAACCATCTCTATGTGAAGCCGCAGGCGGCGGGTCTCGTCAAT
ACCTTGTCGGTGAACACGAATAAGCGTAGCTACGAGTTCACGCTGGTGTCCTCGCCGCTGGGCGGCATCT
TTTACCAGAAAGTGCGCTTCCGCATTCCGACCTCCATCTCGGCCAAGGTCAAGGCGCGCAACGATGCGCG
CGACGAGCAAGGGGAGGATGCCAGGTCAGCCGGGGCCGAAGCGCGCAACCCTGACGCCGTCGGGGTGTCG
CCGGACCAGCTGAACTTCGAGTATTCCATTTCCGGCACCGCCAGCTTCAAGCCGGAGACCGCGTTCGACG
ATGGCAAGGCGCTCTGGCTACGACTGCCTGCCGCCGCGTTGCAGAGCTGGCCGGTCGCGCTGGTGAAGGA
CGGCAGCGACTTTGTCGTGGTCAACCAGATCCGCCGCGGCGGCTATCTGGTGGTGCAGCGCCTCGCCGAT
ACCATCGTCCTGCGCTCCGGTGACGATGAGATCAAGATCGAGCGGGGCCGTCGTCGCGTTCTGGGATTGT
TCTGA
 Primer design