SecReT4
Protein ID: 38638020
T4SS name [ID]Trb [769]
Gene symboltrbB
Locus tagPHG359
StrainRalstonia eutropha H16
Repliconplasmid megaplasmid pHG1 [GenBank: NC_005241] [Browse all T4SS(s) in this replicon]
Location [Strand]373128..374177 [+]
Productchaperonin
Component typeTrbB
UniProt IDQ7WWY3
KEGG IDreh:PHG359
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.3e-64, Aligned region: 29..323
Protein Sequence: 349 a.a.     [Download]
>gi|38638020|ref|NP_942994.1| chaperonin [Ralstonia eutropha H16]
MESASTNHPLLQLTQLADSAVSMFFESLAPLHDVIHADDVAEVMINRHNSIWVERRGIMTRLEIEIDPFK
IEGAIRSLASSVEKSAVRGTAQGIINAGQKGLRIAAVMQPTSIDGHALSIRRHREKNMRLSDYVKAGAFS
SRHARTETETPIFCGPVEDDALAQALGELVRLRKNILVAGGTSSGKTTLLNAMVGEIPPEERVITIEDTT
ELKPSVPNVVRLLSNADKGVTTQHLVALSLRFRPDRILVGEVRGGEAYDMLQAFNTGHDGGMGSLHAPSP
RMALSRLESMALLGIPPGSGWKVEDMRRLIADCIHYVVHMKRSGDMRVLSEIIEIKGFRNNDYEYQRVF
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|38637668|ref|NC_005241.1|:373128-374177 Ralstonia eutropha H16 megaplasmid pHG1, complete sequence
ATGGAATCAGCGTCCACCAACCACCCTCTTCTGCAGCTCACGCAGCTTGCCGACAGCGCCGTGTCGATGT
TCTTCGAATCGCTGGCGCCGTTGCACGATGTCATTCATGCGGATGACGTGGCGGAGGTCATGATCAATCG
CCACAACAGCATCTGGGTCGAGCGACGCGGCATCATGACCCGACTCGAGATCGAGATCGATCCGTTCAAG
ATCGAGGGGGCGATCCGTTCCTTGGCGTCGTCGGTAGAAAAGTCCGCGGTGCGCGGCACGGCCCAGGGCA
TCATCAACGCCGGTCAAAAGGGCCTGCGCATCGCCGCCGTGATGCAGCCAACGTCGATCGACGGCCACGC
TCTGAGCATCCGGCGGCATCGCGAGAAGAACATGCGCCTGTCGGACTATGTGAAGGCCGGCGCGTTCTCA
TCCCGGCATGCGCGCACGGAAACCGAGACGCCCATCTTCTGCGGCCCTGTCGAGGACGACGCACTCGCCC
AGGCGCTCGGCGAGCTAGTCCGCCTGCGCAAGAACATCCTGGTGGCAGGCGGTACGTCTTCAGGCAAGAC
CACGCTACTCAATGCCATGGTCGGCGAGATTCCACCGGAGGAGCGGGTCATCACCATCGAGGACACGACG
GAGCTCAAGCCCAGCGTGCCGAACGTCGTGCGGCTCCTTTCCAACGCCGACAAGGGCGTGACCACGCAGC
ATCTCGTCGCGCTCTCTCTGCGCTTCCGGCCAGACCGGATTCTCGTGGGCGAAGTCCGGGGCGGCGAAGC
GTACGACATGCTCCAGGCCTTTAACACCGGCCACGACGGCGGCATGGGATCGCTGCATGCGCCCAGTCCC
CGCATGGCCTTGTCCCGTCTCGAAAGCATGGCGCTGCTCGGCATCCCGCCCGGTTCCGGCTGGAAAGTCG
AAGACATGCGTCGCCTCATTGCCGACTGCATTCACTACGTTGTGCACATGAAGCGTTCGGGAGACATGCG
CGTGCTCTCCGAGATCATTGAGATCAAGGGCTTTCGCAATAACGACTACGAATACCAACGCGTTTTCTAA
 Primer design