SecReT4
Protein ID: 38638021
T4SS name [ID]Trb [769]
Gene symboltrbC
Locus tagPHG360
StrainRalstonia eutropha H16
Repliconplasmid megaplasmid pHG1 [GenBank: NC_005241] [Browse all T4SS(s) in this replicon]
Location [Strand]374197..374544 [+]
Productprepilin
Component typeTrbC
UniProt IDQ7WWY2
KEGG IDreh:PHG360
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.8e-08, Aligned region: 12..106
Protein Sequence: 115 a.a.     [Download]
>gi|38638021|ref|NP_942995.1| prepilin [Ralstonia eutropha H16]
MTSPFSQRARATARKYAPSALLLVGMMAVATSAVAADDSFLGNLGNFICGIATFINTKYLFVIGLIVIVL
GAYAYANAESSLSKFISGACVGVGLAAAAPSILKTLNIVAACTGF
 
Nucleotide Sequence: 348 bp     [Download]
>gi|38637668|ref|NC_005241.1|:374197-374544 Ralstonia eutropha H16 megaplasmid pHG1, complete sequence
ATGACCTCCCCGTTCTCACAGCGCGCCCGCGCAACAGCTCGCAAGTACGCCCCGTCCGCCTTGCTGCTCG
TCGGCATGATGGCAGTCGCCACCTCCGCCGTCGCCGCGGACGATTCGTTCCTCGGCAATCTTGGCAACTT
CATCTGCGGCATCGCCACCTTCATCAACACGAAGTATCTGTTCGTCATCGGCCTGATCGTCATTGTGCTG
GGCGCCTATGCCTATGCCAATGCCGAATCGAGCCTGTCCAAGTTCATCTCGGGGGCTTGCGTTGGCGTCG
GCCTGGCCGCAGCGGCGCCGTCGATCCTGAAGACGCTGAACATCGTCGCCGCCTGCACCGGCTTCTAA
 Primer design