SecReT4
Protein ID: 38638025
T4SS name [ID]Trb [769]
Gene symboltrbL
Locus tagPHG364
StrainRalstonia eutropha H16
Repliconplasmid megaplasmid pHG1 [GenBank: NC_005241] [Browse all T4SS(s) in this replicon]
Location [Strand]378206..379162 [+]
Productentry exclusion protein
Component typeTrbL
UniProt IDQ7WWX8
KEGG IDreh:PHG364
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.1e-28, Aligned region: 65..286
Protein Sequence: 318 a.a.     [Download]
>gi|38638025|ref|NP_942999.1| entry exclusion protein [Ralstonia eutropha H16]
MIGSQAEESTKTPPSFSGQKGTIAESLKSWVGQFESFRSGLIASATPLSQTIRSETDKVAYGLALITLTL
AGIRFAATNDPTTAWTDIFEAFMLLGIFAGIYLGYDKFAPGIFDWFKMLGDKIAGTRSSNPALTLISVGT
GFLDTYNKAMDAASGLSVLSVALSGIVLIITFVVCAVAALLYSFFIALGEVQAAVGIVVGPLAVALAFSD
YSRRFFVSWLDFMISASMYTVVASVMARLVSSAFTSTMVDQTDIGTQSLAGAAYALGVAIFMLLVALEIP
KMAGAIFGSGGGLSGGAAGRLGMKAASGIGGFLAKKGK
 
Nucleotide Sequence: 957 bp     [Download]
>gi|38637668|ref|NC_005241.1|:378206-379162 Ralstonia eutropha H16 megaplasmid pHG1, complete sequence
ATGATTGGGTCGCAGGCGGAAGAATCCACCAAGACCCCGCCGTCATTCTCCGGACAGAAAGGGACGATCG
CCGAATCTCTCAAAAGTTGGGTCGGCCAGTTCGAGTCGTTTCGCAGCGGCCTGATCGCAAGCGCTACACC
GCTGAGTCAGACCATCCGATCGGAGACCGACAAGGTGGCTTATGGCTTAGCACTCATCACGCTGACTCTG
GCCGGCATCCGATTCGCTGCAACGAACGATCCGACCACGGCGTGGACGGACATTTTTGAGGCGTTCATGC
TCTTGGGGATCTTCGCAGGGATCTATTTGGGGTACGACAAGTTCGCACCGGGAATTTTTGACTGGTTCAA
AATGCTCGGCGACAAGATCGCCGGTACTCGCTCCAGCAATCCGGCCTTGACGCTCATCTCGGTAGGCACC
GGCTTCCTCGACACCTACAACAAGGCTATGGACGCGGCAAGCGGCCTCTCCGTCCTTAGCGTAGCCCTTT
CCGGGATCGTCCTCATCATTACATTTGTGGTCTGTGCGGTTGCAGCGCTGCTCTACAGCTTCTTCATCGC
TTTAGGGGAGGTTCAGGCCGCCGTCGGCATCGTCGTGGGCCCTCTCGCTGTCGCGCTCGCATTCTCGGAT
TATTCGCGCCGCTTCTTCGTCTCTTGGCTCGATTTCATGATTAGCGCCTCGATGTACACGGTCGTTGCCT
CCGTCATGGCGCGACTCGTCTCCAGCGCATTCACTTCCACCATGGTCGATCAGACTGACATCGGCACCCA
GTCCCTTGCGGGCGCTGCCTATGCGCTCGGCGTCGCGATTTTCATGCTGCTTGTCGCACTGGAGATCCCC
AAGATGGCGGGCGCAATCTTCGGCTCCGGAGGCGGGCTGAGCGGGGGTGCGGCCGGGCGTCTGGGCATGA
AAGCCGCTAGCGGAATCGGCGGGTTCCTGGCCAAGAAGGGCAAGTGA
 Primer design