SecReT4
Protein ID: 38638136
T4SS name [ID]Tra_I [183]
Gene symboltraL
Locus tagpEL60p47
StrainErwinia amylovora plasmid pEL60 (NC_005246)
Repliconplasmid pEL60 [GenBank: NC_005246] [Browse all T4SS(s) in this replicon]
Location [Strand]37096..37650 [+]
Productconjugative transfer protein
Component typeTraL_I
UniProt IDQ6TFU9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 184 a.a.     [Download]
>gi|38638136|ref|NP_943246.1| conjugative transfer protein [Erwinia amylovora]
MLQKEKMMKGENRLMHQSQSQRLGHKTKTLLVAVGFSCISVSSFAATQTCAAYELAKAGADAAYKQEVER
INNAAKSESSTSDSLGQCLGSLSVSLKIPQFPSISDIIDKVKDEVCNTVKSKINEKWGSLTNTTLDPWST
ISSRLPDTSGILPNASSKNVQLNNPAAASGSGEDANSDAFPFHL
 
Nucleotide Sequence: 555 bp     [Download]
>gi|38638089|ref|NC_005246.1|:37096-37650 Erwinia amylovora LebB66 plasmid pEL60, complete sequence
ATGCTGCAAAAAGAAAAGATGATGAAAGGAGAGAACAGACTCATGCACCAGTCGCAAAGTCAGCGCCTCG
GCCATAAAACAAAAACCCTACTCGTAGCAGTAGGGTTTTCCTGCATTTCTGTGAGCTCATTTGCAGCCAC
ACAGACCTGTGCAGCATACGAACTGGCAAAAGCTGGTGCTGATGCTGCCTATAAACAGGAGGTTGAACGG
ATTAACAACGCCGCTAAAAGTGAATCCAGTACATCTGATTCTCTCGGACAGTGCCTGGGGTCGCTATCGG
TATCACTAAAAATCCCTCAGTTTCCGTCTATCAGCGACATCATTGATAAGGTGAAGGATGAGGTATGCAA
TACGGTTAAATCGAAGATTAATGAGAAGTGGGGGAGCCTGACTAATACGACGCTGGACCCGTGGTCAACG
ATTTCATCCCGACTGCCAGATACGTCAGGTATCCTGCCCAACGCATCTTCTAAGAATGTGCAATTAAACA
ATCCGGCAGCTGCGAGTGGAAGTGGTGAGGATGCAAACAGTGATGCATTCCCGTTCCATTTGTAA
 Primer design