SecReT4
Protein ID: 38638138
T4SS name [ID]Tra_I [183]
Gene symboltraM
Locus tagpEL60p49
StrainErwinia amylovora plasmid pEL60 (NC_005246)
Repliconplasmid pEL60 [GenBank: NC_005246] [Browse all T4SS(s) in this replicon]
Location [Strand]38244..39026 [+]
Productconjugative transfer protein
Component typeTraM_I
UniProt IDQ6TFU7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 9.1e-32, Aligned region: 109..216
Protein Sequence: 260 a.a.     [Download]
>gi|38638138|ref|NP_943248.1| conjugative transfer protein [Erwinia amylovora]
MYTSLFINDLRDFLTQTFEKRNSMKTQNGENIMDQTDSDQNSVVDDDSNALAPALAEESNRTVQEIVSKH
GLKVILIQTLIILVAIIIIGLQGYWLHQKKTKYIATNGGMITEVHPTDEPAYTAEEVMDFANRTMIKSLS
LNFVNYENQLTSVRGDFSAEGYVSFRKALTDSGLLKDISEKRLNVKLSTTPGTLITEGLIRGTKTYAWQY
RIPVTVQLVGQAQDYRPQPYDLMVQVRRVKEDEDPRGIQVAQAILKPRNY
 
Nucleotide Sequence: 783 bp     [Download]
>gi|38638089|ref|NC_005246.1|:38244-39026 Erwinia amylovora LebB66 plasmid pEL60, complete sequence
ATGTATACCTCATTGTTCATTAACGATCTGCGTGATTTTCTAACACAAACTTTTGAAAAGAGAAACTCTA
TGAAAACACAAAATGGTGAAAATATTATGGATCAAACTGACTCGGATCAAAACTCAGTCGTTGATGATGA
CAGCAACGCCCTTGCTCCAGCTCTGGCTGAAGAGAGTAACCGAACGGTACAAGAAATCGTATCGAAACAT
GGTTTAAAAGTAATTTTGATTCAGACGCTAATCATATTAGTCGCAATCATTATCATCGGTCTTCAGGGGT
ACTGGCTACACCAGAAAAAAACTAAATACATTGCAACGAATGGGGGCATGATCACAGAAGTACACCCAAC
CGATGAACCGGCTTACACAGCGGAAGAGGTGATGGACTTTGCCAACCGTACAATGATCAAATCGCTTTCA
CTGAACTTTGTGAATTACGAAAACCAATTAACCAGCGTCCGTGGCGATTTTAGCGCTGAGGGGTACGTTA
GTTTCCGTAAAGCGCTGACCGATAGTGGACTGCTGAAAGATATCAGTGAAAAACGACTGAACGTAAAACT
TTCCACAACACCAGGAACCCTGATCACGGAAGGTCTTATCCGTGGCACCAAAACCTATGCCTGGCAATAC
CGCATTCCGGTGACTGTTCAGCTTGTTGGTCAGGCTCAGGACTACAGACCACAACCTTACGATTTGATGG
TTCAGGTACGCCGCGTCAAAGAAGACGAAGATCCACGGGGTATTCAAGTAGCGCAGGCCATTCTCAAACC
CCGGAACTACTGA
 Primer design