SecReT4
Protein ID: 38638145
T4SS name [ID]Tra_I [183]
Gene symboltraU
Locus tagpEL60p56
StrainErwinia amylovora plasmid pEL60 (NC_005246)
Repliconplasmid pEL60 [GenBank: NC_005246] [Browse all T4SS(s) in this replicon]
Location [Strand]43760..46810 [+]
Productconjugative transfer protein
Component typeTraU_I
UniProt IDQ6TFU0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.3e-61, Aligned region: 490..888
Protein Sequence: 1016 a.a.     [Download]
>gi|38638145|ref|NP_943255.1| conjugative transfer protein [Erwinia amylovora]
MISFFEDVIEGISRNLTSNDSLKYCDLTTVVGLTSQDRVEHPEIRAPYILTTKNNDFLTVIEVQGAKSSF
DEKSFNDFIMHLSNSLSNSFINSGHKLSVVFERDFTKNQEELNNVYKPQVAAIERLQIDIKDLIADDAKK
IAAHYSRERAYIVLYTSKGMIAKDELKNEQAKAAGVMKDIPQTRFSQNPIEFQLEGLKITHDAMLWRLIG
MLQGDDESGMGLLVDVLDVKHAGAMMRQMLFRNSTSENWYPRTPFDQNLRVYGAPRKGNIDSVLPPRLNI
QIMEGELEEDGGLIYCDGKYYGSVALELPPLHPVKFKQLFNAINRKIPYRIKYDFMGGGKKALFWPSVII
SFLRFIPSLGTIARDMDYVGAQSETDPTAIMAINFATWGDTKDEAKRNLAALTKAIEGWGVSGVSKTYGN
PGSALIASVPGLTTATPGSLHYPPLSEGLRMLPFERPASPWHGKGNINFITLDGKLFPYQIASPLQEKFT
DVITGVPGSGKSVLANRLNLSAIFRADKKLPYLTIIDKGYSAKGIADLIWAELPADLRHLVASITLNNDE
SHCINICDTQLGSRYLTQFEEVFLKQMLNAFCIDPAIGQPPDAMSVGQIVSKVVSRVYKAKAHSDANKFK
FNDPVVNEALKVSGLDTELGEDWFEKATWWEVVDKLFAKKYFHAATVAQRYAVPTIYDFISELQEEGFSK
QYADVKVNGSEPVVNFVARCFQAAAADYAIFSGITVYDFSPETRIAILDMQNVLGDRTTPAGKLKSGIMY
LFARQMAVRNYYLPQSAETFIPALPEQYRAYHQARIRELSEEVKHTFYDECHNFAGIDFIQNALNTADLE
DRKFNVRTAFSSQYLSHMPSSVLKTMNSLFMMRLTEGDEEYLKQLEINIPADILRRFRQLPQGVYPDGSG
TAFLGIFKTKRGLICHILKNTLGPKLLWALNSSAKDRALRDVLYEELGTKQAREVLANRFPMGSASSIID
EMVVNQGGERDSEEESQTMAMKLAKEIISDVRRGFR
 
Nucleotide Sequence: 3051 bp     [Download]
>gi|38638089|ref|NC_005246.1|:43760-46810 Erwinia amylovora LebB66 plasmid pEL60, complete sequence
ATGATTTCTTTCTTTGAGGATGTGATCGAAGGTATCTCACGCAATCTTACGTCAAATGACTCGTTAAAAT
ACTGTGATTTGACAACGGTTGTAGGGCTTACGTCGCAGGATCGCGTTGAGCATCCTGAAATCAGGGCTCC
GTACATTCTGACCACGAAGAACAACGATTTTCTTACCGTTATTGAGGTTCAGGGCGCTAAATCATCGTTT
GACGAGAAGTCGTTTAATGACTTCATCATGCACCTTTCAAACTCGTTGTCGAATTCCTTTATTAACAGTG
GCCATAAGCTGTCTGTGGTGTTTGAGCGCGACTTTACCAAGAACCAGGAAGAACTGAATAATGTTTATAA
ACCGCAGGTAGCAGCAATAGAGCGCCTGCAGATAGACATTAAAGACCTGATCGCCGATGACGCAAAAAAA
ATTGCTGCCCATTACAGCCGTGAACGCGCTTACATCGTGCTGTATACCTCGAAGGGGATGATTGCGAAGG
ATGAACTTAAAAACGAGCAGGCAAAAGCTGCCGGCGTTATGAAGGATATCCCGCAGACTCGCTTCAGTCA
GAACCCAATCGAATTTCAGCTTGAAGGTTTGAAGATCACGCATGACGCGATGCTGTGGCGGCTGATTGGT
ATGCTTCAGGGGGATGATGAGTCGGGGATGGGGCTTTTGGTTGATGTCCTCGATGTCAAACACGCCGGCG
CCATGATGCGTCAGATGCTGTTCCGGAACTCAACATCAGAAAACTGGTACCCTCGCACGCCGTTTGACCA
AAATCTGCGAGTTTATGGCGCTCCACGGAAAGGCAATATCGACTCAGTGCTGCCGCCGCGGCTGAATATC
CAGATCATGGAAGGGGAACTGGAAGAAGATGGTGGCCTGATTTACTGCGATGGCAAGTATTACGGCTCTG
TTGCCCTTGAGTTGCCACCACTTCACCCTGTCAAATTTAAGCAGTTATTCAACGCGATTAACCGGAAAAT
CCCGTACCGGATAAAATATGACTTTATGGGCGGGGGCAAAAAAGCACTGTTCTGGCCATCAGTGATCATC
TCTTTCCTTCGTTTCATTCCCTCACTCGGTACTATCGCGCGTGATATGGATTATGTCGGGGCCCAGAGCG
AAACCGATCCAACGGCTATCATGGCCATCAACTTTGCCACCTGGGGTGACACTAAGGATGAAGCCAAACG
CAACCTGGCGGCCTTAACTAAGGCGATTGAAGGCTGGGGTGTATCAGGTGTGTCCAAGACGTATGGTAAT
CCAGGTAGCGCACTGATTGCATCCGTTCCGGGGCTGACGACGGCCACACCTGGCTCATTGCATTATCCGC
CGTTGAGTGAAGGCTTGCGGATGTTACCTTTTGAACGTCCGGCCAGCCCCTGGCATGGTAAAGGCAATAT
CAACTTCATCACGCTCGATGGCAAGCTGTTCCCTTATCAAATCGCCAGTCCCCTGCAGGAGAAATTTACC
GATGTCATCACCGGTGTTCCTGGTTCCGGTAAAAGCGTGCTGGCCAACCGTCTTAACCTGAGCGCGATTT
TCCGGGCAGATAAAAAATTGCCTTATCTGACCATCATTGATAAGGGATACAGTGCGAAAGGTATTGCCGA
CCTGATTTGGGCTGAATTGCCGGCGGATCTACGACACCTGGTTGCCAGTATCACCCTGAACAATGACGAA
TCGCACTGTATTAACATCTGCGATACGCAGTTAGGTTCAAGGTATCTGACGCAGTTTGAGGAAGTATTCT
TAAAGCAGATGCTTAACGCATTCTGTATTGATCCGGCAATTGGCCAGCCGCCAGATGCAATGAGCGTTGG
CCAAATCGTCAGTAAAGTTGTATCAAGAGTATACAAAGCAAAAGCTCATTCTGACGCAAATAAGTTTAAG
TTTAACGATCCGGTTGTTAATGAAGCTCTGAAAGTATCTGGTCTGGATACAGAGCTCGGTGAAGACTGGT
TTGAAAAAGCTACATGGTGGGAAGTCGTTGATAAGCTGTTTGCCAAAAAATATTTCCATGCAGCGACGGT
TGCCCAGCGTTATGCTGTGCCGACCATTTACGATTTCATTAGCGAGCTACAAGAAGAAGGTTTTAGTAAG
CAATATGCGGATGTAAAAGTCAATGGAAGTGAGCCTGTAGTAAACTTTGTTGCACGTTGTTTCCAGGCTG
CCGCTGCTGACTATGCCATTTTCTCTGGGATCACGGTTTATGATTTCAGCCCAGAGACTCGTATTGCGAT
CCTGGATATGCAAAACGTGCTCGGTGACAGAACGACACCTGCAGGCAAGCTCAAATCCGGCATTATGTAT
CTCTTTGCGCGCCAGATGGCAGTGCGTAACTACTATCTACCTCAGTCAGCAGAAACCTTCATTCCTGCTT
TACCGGAGCAGTACAGGGCATATCACCAGGCGCGCATCAGGGAGCTTTCAGAAGAGGTTAAACATACCTT
TTATGATGAGTGTCATAACTTTGCCGGCATCGACTTTATTCAAAATGCGCTGAATACCGCTGACCTTGAA
GATCGTAAATTCAACGTCCGTACTGCGTTCTCGTCTCAGTATCTGAGCCATATGCCTTCGAGCGTGCTTA
AAACCATGAACAGCCTGTTTATGATGCGCCTGACGGAAGGGGATGAAGAGTATCTGAAGCAATTAGAGAT
AAACATCCCGGCCGATATCCTGCGTCGTTTCAGACAGCTTCCGCAAGGGGTTTATCCGGACGGAAGTGGT
ACTGCATTTCTCGGTATTTTTAAAACGAAACGTGGTCTTATTTGCCATATACTAAAAAATACATTAGGTC
CAAAACTGCTTTGGGCATTGAACTCTTCTGCAAAAGATAGGGCGCTCAGGGATGTGCTTTATGAAGAGCT
GGGAACGAAACAAGCAAGGGAAGTATTAGCAAATAGATTCCCTATGGGAAGTGCATCAAGTATCATAGAT
GAAATGGTGGTCAATCAGGGTGGTGAGCGTGATTCAGAAGAAGAATCACAAACTATGGCGATGAAACTCG
CTAAAGAAATCATTTCTGATGTGAGAAGGGGATTCAGATGA
 Primer design