SecReT4
Protein ID: 38638174
T4SS name [ID]VirB [611]
Gene symbolvirB8
Locus tagpEU30p16
StrainErwinia amylovora plasmid pEU30 (NC_005247)
Repliconplasmid pEU30 [GenBank: NC_005247] [Browse all T4SS(s) in this replicon]
Location [Strand]13486..14295 [+]
Productconjugative transfer protein
Component typeVirB8
UniProt IDQ6TFR2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.7e-33, Aligned region: 54..258
Protein Sequence: 269 a.a.     [Download]
>gi|38638174|ref|NP_943283.1| conjugative transfer protein [Erwinia amylovora]
MFSKKIKKATEKERHIHYGDGGLSGKDREINQLVKAYTDMAKLFEKNIVDDLVGKVLFWRKSSALGWSMV
VVALIAIMGLTPLKTVVPYLLRTDSSSGGANIVRPAFERGDTLGVKQDKHFIMAWVLAHESYNWATQPAN
YAFIQQTSSDSVFSQYKNFQLSKKGFVETLGQNQQVKVDLDWITPLAKGPESKFTKGKDVRTYQVSYRQT
LLMADNQPVPEVKPVFWVGIMTLNNENPPKNEADEWSNPAGYLALDWQPTQSSGKGGSE
 
Nucleotide Sequence: 810 bp     [Download]
>gi|38638158|ref|NC_005247.1|:13486-14295 Erwinia amylovora UTRJ2 plasmid pEU30, complete sequence
ATGTTCAGTAAGAAAATAAAAAAGGCCACAGAAAAGGAACGCCATATCCATTATGGCGATGGTGGCCTGT
CAGGCAAGGACAGAGAAATTAATCAGCTGGTCAAAGCCTATACGGATATGGCGAAACTGTTTGAAAAGAA
TATTGTGGACGATCTAGTCGGAAAAGTCCTCTTCTGGCGAAAAAGTTCCGCCTTGGGCTGGTCAATGGTG
GTGGTCGCCTTGATTGCAATAATGGGCCTGACACCGCTTAAAACCGTTGTGCCTTATCTTTTGCGGACCG
ACAGCTCCAGTGGTGGTGCAAATATCGTCCGGCCCGCGTTCGAACGCGGCGATACACTGGGAGTGAAACA
GGATAAACACTTCATCATGGCATGGGTGCTGGCGCACGAGTCATACAATTGGGCAACGCAGCCTGCAAAC
TATGCCTTTATCCAGCAGACATCCTCAGACAGCGTTTTCTCACAGTACAAAAACTTTCAGCTCTCCAAGA
AAGGGTTTGTTGAAACGCTGGGGCAGAATCAGCAGGTGAAAGTAGATCTCGACTGGATTACCCCTCTAGC
GAAAGGCCCGGAATCGAAGTTCACCAAAGGAAAAGATGTGCGTACATATCAGGTCAGCTACCGTCAGACC
CTACTGATGGCTGATAACCAGCCGGTGCCGGAGGTTAAGCCTGTTTTCTGGGTAGGGATAATGACACTCA
ATAATGAAAACCCACCTAAAAACGAAGCTGACGAATGGAGCAATCCTGCAGGTTATCTGGCGCTTGACTG
GCAGCCAACGCAGTCCAGCGGAAAAGGGGGTAGTGAATGA
 Primer design