SecReT4
Protein ID: 38638177
T4SS name [ID]VirB [611]
Gene symbolvirB11
Locus tagpEU30p19
StrainErwinia amylovora plasmid pEU30 (NC_005247)
Repliconplasmid pEU30 [GenBank: NC_005247] [Browse all T4SS(s) in this replicon]
Location [Strand]17263..18345 [+]
Productconjugative transfer protein
Component typeVirB11
UniProt IDQ6TFQ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.2e-46, Aligned region: 33..323
AAA_17 [PF13207], Evalue: 8.5e-05, Aligned region: 183..215
Protein Sequence: 360 a.a.     [Download]
>gi|38638177|ref|NP_943286.1| conjugative transfer protein [Erwinia amylovora]
MSDNRTILEVDELAEDALVRGLLHKTGVYERLMVPGVEEVAINRPYEIWTKFSDRGWVREEMPELILAEC
KYLINALAVSNFRELTIMSPIATVELPGGEGYRAQLVIPPACERNTVSMTFRKPSLERFTLEDYVKSGRF
DNANRHSHRQTELADWQKSLKHLNRDRQFEAFFRMAVERKLNIIIFGGTGSGKTTFAKAVVDVYPPGCRL
LTIEELNELKLPLHLNHVHLLYGDHVTPKELVSCCQRMNGDHIFLAELTGDEAWDYMEVLNTGKPGSITT
AHANSSAEGYARITGLIKQSRVGAGLDIYYIERRVRTSFDVVMYMEGTQILDVTYDPEIKLALLNGASLD
AALQMAREAE
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|38638158|ref|NC_005247.1|:17263-18345 Erwinia amylovora UTRJ2 plasmid pEU30, complete sequence
ATGAGCGATAACCGCACGATTTTAGAGGTTGACGAACTGGCTGAAGATGCACTGGTGCGTGGTTTACTCC
ACAAAACCGGCGTGTACGAAAGGCTGATGGTTCCAGGCGTAGAAGAGGTTGCTATAAACAGGCCTTACGA
AATATGGACCAAGTTTAGTGACAGAGGATGGGTGCGCGAGGAAATGCCTGAACTTATCTTGGCCGAATGT
AAATACCTCATCAATGCCCTGGCGGTTTCAAACTTCAGGGAACTGACCATCATGTCACCCATCGCTACTG
TGGAGCTGCCGGGTGGCGAGGGTTACCGTGCTCAACTTGTCATACCGCCTGCCTGTGAGCGTAATACGGT
TTCAATGACGTTCCGTAAGCCGTCGCTGGAACGCTTTACCTTGGAAGATTACGTCAAGAGTGGGCGCTTT
GATAATGCCAACCGGCACTCACACCGACAGACGGAACTGGCCGACTGGCAGAAAAGCCTCAAGCATCTAA
ATCGCGATCGTCAGTTCGAAGCATTTTTCAGGATGGCCGTAGAGCGCAAGCTGAACATTATCATTTTTGG
CGGCACCGGTTCCGGTAAGACCACCTTTGCAAAGGCGGTCGTGGACGTGTATCCGCCAGGGTGCAGGCTA
CTGACCATTGAAGAACTCAACGAGCTGAAGCTACCGCTGCACCTCAACCATGTGCATCTCCTGTACGGTG
ACCATGTCACGCCGAAAGAGCTGGTTTCATGCTGCCAGCGTATGAATGGCGATCATATCTTTCTGGCCGA
ACTGACCGGCGATGAGGCGTGGGACTACATGGAAGTGCTGAATACCGGTAAGCCTGGCTCTATCACCACG
GCGCATGCCAACAGCAGCGCGGAAGGTTATGCGCGGATCACAGGCCTTATCAAGCAGTCTCGCGTGGGGG
CGGGCCTCGATATTTATTATATTGAGCGCCGGGTGCGCACCTCGTTTGATGTGGTGATGTACATGGAAGG
AACCCAAATCCTCGATGTGACCTATGATCCAGAAATTAAACTGGCACTGCTGAACGGGGCCTCTCTTGAC
GCCGCTTTGCAAATGGCGCGGGAGGCGGAATGA
 Primer design