SecReT4
Protein ID: 38638178
T4SS name [ID]VirB [611]
Gene symbolvirD4
Locus tagpEU30p20
StrainErwinia amylovora plasmid pEU30 (NC_005247)
Repliconplasmid pEU30 [GenBank: NC_005247] [Browse all T4SS(s) in this replicon]
Location [Strand]18695..20302 [+]
Productconjugative transfer protein
Component typeVirD4
UniProt IDQ6TFQ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.6e-61, Aligned region: 32..477
TraG-D_C [PF12696], Evalue: 1.1e-23, Aligned region: 318..441
TrwB_AAD_bind [PF10412], Evalue: 7.5e-15, Aligned region: 267..460
Protein Sequence: 535 a.a.     [Download]
>gi|38638178|ref|NP_943287.1| conjugative transfer protein [Erwinia amylovora]
MSRKQKGVPPGWENVDGKLIQREIVTFPPLLLGKDPYSGNFIAAYGQTYLKLAAPPSSGKDVGVVTPNLL
QYSHSIVCNDIKFESFNDTAGYRHACGQRVYRFSPGLLDTHHWNPFRYVRTDPLNRLGDLRSMGASLYIP
DNEKNASWYENASSAWVAISLFLLETDGEYPLSLPQVYEIVSLGQDMGAWFQQQIDERKAKNKPLSDETV
RELTGLIAATKGKNFSELLNFITRPMKVYGEKTVALAVTDSDDPAENIEFSRLRQERTTIYFCVTEPEMK
KFAGLMNLFYSQAIRANSKLLPKHGGNLDDGSLRYKYQVLLLMNEFAVMGRMEVMETAPALTRGNGLRYA
IIFQNENQVCSSTCYGREGGRALLGTFHNDIVFTPGDMDVATEYSKRLGNTTVRVPSDNTSVSEGSRRSK
GRTWSLQSRPLMLPQEVNELPYSDELIFMAATKNTPALKIHAKKIIWYEEPVFIERVDWQRYPLPPVPVG
NADKIKGLVKTVVSPSRNVKLANPQGDDIRREDARRIRADRKEIT
 
Nucleotide Sequence: 1608 bp     [Download]
>gi|38638158|ref|NC_005247.1|:18695-20302 Erwinia amylovora UTRJ2 plasmid pEU30, complete sequence
ATGAGCAGGAAACAAAAAGGTGTTCCGCCTGGCTGGGAGAATGTGGATGGCAAGCTGATCCAGCGAGAAA
TTGTCACCTTCCCGCCGCTATTGCTTGGTAAAGACCCCTATTCCGGTAATTTCATCGCGGCGTATGGCCA
GACCTACCTCAAACTTGCCGCGCCACCATCCAGTGGTAAAGACGTGGGTGTGGTCACTCCTAACCTTTTG
CAATACTCACACAGCATTGTGTGTAACGACATCAAGTTTGAAAGTTTTAACGACACGGCTGGCTATCGTC
ATGCTTGCGGACAACGGGTCTACCGTTTCTCTCCGGGGCTGCTGGATACGCACCACTGGAACCCGTTTCG
CTACGTCAGGACAGACCCTTTAAACCGTCTGGGGGATTTACGATCAATGGGGGCATCGCTCTACATACCG
GACAACGAAAAAAATGCTTCCTGGTATGAAAACGCCTCCAGTGCGTGGGTGGCAATATCCCTTTTCCTGT
TGGAAACAGATGGGGAATATCCCCTCTCGCTGCCACAGGTCTATGAAATTGTTTCGCTCGGTCAGGACAT
GGGCGCGTGGTTTCAGCAGCAGATAGACGAACGTAAGGCGAAGAATAAGCCGCTTTCGGATGAGACGGTA
CGTGAGTTAACCGGCCTGATAGCAGCGACAAAAGGTAAAAACTTTTCAGAGTTACTCAACTTCATCACCC
GGCCAATGAAGGTATACGGTGAAAAAACGGTGGCGCTGGCCGTTACCGACAGTGACGACCCGGCTGAAAA
TATTGAGTTCAGCCGTCTGCGCCAAGAACGGACAACCATTTACTTCTGCGTTACAGAACCGGAAATGAAG
AAGTTTGCCGGGCTGATGAACCTGTTCTATTCACAGGCAATTCGCGCCAACAGCAAGCTACTGCCAAAGC
ACGGCGGTAACCTTGATGACGGCTCACTCCGGTATAAATATCAGGTACTGTTACTGATGAATGAGTTTGC
CGTTATGGGCCGAATGGAGGTAATGGAAACCGCTCCGGCGCTGACTCGCGGGAATGGGTTGCGTTATGCC
ATCATATTCCAGAATGAAAATCAGGTGTGCTCTTCCACCTGTTATGGACGTGAAGGCGGCCGGGCTTTGT
TGGGAACATTCCATAACGATATCGTCTTTACGCCGGGGGATATGGACGTTGCCACCGAATACAGCAAGCG
GCTGGGTAACACCACCGTGCGCGTGCCTTCTGATAACACCAGCGTATCTGAAGGTAGTCGCCGGTCAAAA
GGCCGCACCTGGTCTTTACAGTCGCGTCCTTTGATGCTCCCACAGGAGGTCAACGAGTTGCCTTACAGTG
ACGAGCTTATCTTCATGGCCGCCACCAAAAATACACCGGCGCTAAAAATCCACGCCAAAAAAATCATATG
GTACGAAGAACCCGTGTTTATAGAACGGGTTGATTGGCAACGGTATCCCCTGCCCCCCGTTCCTGTCGGG
AACGCAGACAAAATCAAAGGGCTGGTGAAAACGGTAGTGTCGCCGTCCAGGAACGTGAAGCTGGCCAATC
CGCAGGGTGACGATATTCGCCGGGAAGATGCCCGCCGTATTCGCGCTGACAGGAAGGAAATAACTTGA
 Primer design