SecReT4
Protein ID: 38639490
T4SS name [ID]VirB [211]
Gene symbolvirB4
Locus tagpXcB_p06
StrainXanthomonas citri plasmid pXcB (NC_005240)
Repliconplasmid pXcB [GenBank: NC_005240] [Browse all T4SS(s) in this replicon]
Location [Strand]3868..6501 [+]
ProductVirB4
Component typeVirB4
UniProt IDQ7X128
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.1e-20, Aligned region: 242..447
AAA_10 [PF12846], Evalue: 8.6e-15, Aligned region: 510..790
Protein Sequence: 877 a.a.     [Download]
>gi|38639490|ref|NP_942610.1| VirB4 [Xanthomonas citri]
MSLSMPVPEGAAADAKEMALSDMIPYTVHYDDESVITKDDGLVQVIKLDGLYFESLTAEQIKQFEHRRNT
VLRSIANSDRGVYVHLIRRKVNLYPAGEGGTWFARRFNQAWRERYNTRSFYVNEIYISIVRNRFRQGAPG
ILDRAFSLLSGSKVTKEDLESFEAQAKDLNEAANLVVQTLSGYGARKLRIQRRPEFVLDRVSRADAQVAV
ERFKMSWQEFQRSHGHHDVYRRDEVLDYLGEDFTEIGGFLHYLVNLEDERVPVTEMQLDRTLAVSSLDFK
MLSNMMAVQNLSGTRAGAMLSMAEWPARTPSRMLDEFLKQPVEYIITQSFFFTDRISAEHDMRQERRRIA
VNDREGVAEEDKDEITKGLQDLTRGRSVNGLHHLTMLVHVPATTQFADPIENKRQTIADLDGAVGLLKKA
FVNLGVKPVREWFAVETFFWAQLPGQAQHFMGRRGKIKSGNFAGFASLHNFAVGKIDGNLWGPAIMPFET
ESGTAYYFNFHREMEGMVAGHLALTADTGGGKTTLLAAFIAMADKARPRVFWFDNREGAKVFMRAMGGQH
TTLTVQGNTGWNPMKLPDTPENRAYLVELLTLMRTCYGGKLVPDDIDRFKKAVHENYALAYPDRRLRNVA
WCFGQGELAKDMRVWHGANGIEGANWGVFDNAHDNIDLTKCRHYCYEMRQLIKDGTARPELPVVLSYPFH
RIEQSMNGEPFILVLEEGQNLVKHAYWREKIDSYIMQIRRKNGLLVFVTPDAKYLYCETDSIQKQTATKI
YLPNGEANRTDLVDVLGLTPGEYEFVRDTPPENRTFLIRRGNESIKAKFDLSDMPAFIPVLSSNDKGVAL
MDEIIRELETDDPEQWVPVFMERALAKNTHNLKQKGA
 
Nucleotide Sequence: 2634 bp     [Download]
>gi|38639487|ref|NC_005240.1|:3868-6501 Xanthomonas citri plasmid pXcB, complete sequence
ATGTCGCTGTCGATGCCGGTGCCGGAAGGTGCCGCCGCCGACGCCAAGGAAATGGCCTTAAGCGACATGA
TCCCGTACACCGTTCACTACGACGACGAATCGGTCATCACCAAGGATGACGGTCTGGTACAGGTTATCAA
GCTCGACGGCCTGTACTTCGAGTCGTTGACTGCCGAGCAAATCAAACAGTTCGAGCACCGGCGCAACACG
GTGTTGCGCTCCATCGCCAACAGCGACCGGGGCGTCTATGTCCACCTGATCCGCCGCAAGGTGAACCTGT
ATCCGGCAGGAGAGGGCGGCACATGGTTCGCGCGGCGCTTCAATCAGGCGTGGCGCGAGCGGTATAACAC
GCGCTCGTTCTATGTGAACGAAATCTACATCTCCATCGTCCGCAACCGCTTCCGACAAGGGGCGCCCGGC
ATCTTGGATCGTGCGTTTTCATTGCTGTCAGGCTCCAAGGTCACGAAAGAAGACCTTGAGTCGTTCGAGG
CACAGGCAAAAGACCTCAACGAAGCCGCTAACCTCGTGGTGCAAACGTTGTCCGGCTATGGCGCTCGCAA
GCTGCGCATCCAGCGGCGACCGGAATTCGTGCTCGACAGGGTAAGCCGTGCTGATGCGCAGGTTGCCGTC
GAGCGATTCAAGATGAGCTGGCAAGAGTTCCAGCGCTCGCACGGTCATCACGACGTGTATCGCCGCGATG
AAGTGCTCGACTATCTCGGTGAGGATTTCACCGAGATCGGTGGTTTCCTGCACTACCTGGTCAATCTGGA
AGATGAACGCGTACCGGTCACGGAGATGCAGCTCGACCGCACGCTCGCGGTGTCGTCCCTCGACTTCAAG
ATGCTCAGCAACATGATGGCCGTCCAGAACCTGAGCGGTACGCGGGCCGGGGCCATGCTGAGCATGGCCG
AGTGGCCGGCTCGCACGCCGTCGCGGATGCTTGACGAATTTCTCAAGCAGCCAGTCGAGTACATCATCAC
GCAGTCGTTCTTCTTTACCGACCGGATCAGCGCCGAGCACGACATGCGGCAGGAGCGCCGACGCATTGCG
GTCAATGACCGTGAGGGCGTGGCGGAAGAGGACAAGGACGAGATTACCAAGGGCCTGCAAGACTTGACGC
GCGGTCGCTCGGTCAATGGTCTGCATCACCTGACCATGCTCGTACATGTGCCGGCCACGACGCAATTTGC
CGATCCTATCGAAAACAAGCGACAGACGATTGCCGATCTCGATGGCGCGGTCGGGCTACTCAAGAAAGCG
TTCGTGAATCTCGGCGTCAAGCCGGTGCGCGAGTGGTTCGCGGTGGAGACGTTCTTTTGGGCGCAGCTTC
CCGGCCAGGCGCAGCACTTCATGGGCCGGCGCGGCAAGATCAAGTCGGGCAATTTCGCCGGCTTCGCCTC
GTTGCACAACTTCGCAGTCGGCAAGATCGACGGCAACCTGTGGGGGCCGGCCATCATGCCTTTCGAGACA
GAGAGCGGCACGGCCTACTACTTCAACTTCCATCGCGAAATGGAAGGGATGGTCGCCGGTCATTTGGCGC
TCACAGCGGACACCGGTGGGGGTAAGACAACCTTGCTGGCCGCGTTCATTGCGATGGCCGACAAGGCCCG
CCCGCGCGTGTTCTGGTTCGATAACCGCGAAGGCGCGAAGGTATTCATGCGTGCAATGGGCGGCCAGCAC
ACGACCCTGACCGTGCAGGGCAATACGGGCTGGAATCCGATGAAGTTGCCCGATACGCCGGAGAACCGCG
CCTATCTGGTCGAGCTGCTCACGCTCATGCGCACATGCTACGGCGGCAAGCTCGTGCCCGATGACATTGA
TCGCTTCAAGAAGGCTGTCCACGAGAACTACGCGCTGGCCTATCCAGATCGCCGCCTGCGCAATGTGGCG
TGGTGTTTCGGCCAAGGCGAGTTGGCGAAGGACATGCGCGTATGGCATGGCGCAAACGGCATCGAGGGCG
CGAACTGGGGCGTGTTCGACAACGCGCACGACAACATCGACCTGACCAAGTGCCGGCACTACTGCTACGA
GATGCGGCAGCTCATCAAGGACGGCACGGCTCGGCCTGAGCTGCCGGTGGTGTTGAGCTACCCCTTCCAT
CGCATCGAGCAGTCCATGAACGGCGAGCCGTTCATCCTCGTGCTGGAAGAAGGGCAGAACCTCGTCAAGC
ACGCGTATTGGCGCGAAAAGATCGACAGCTACATCATGCAGATTCGCCGCAAGAACGGTCTGCTGGTCTT
TGTCACACCTGACGCCAAGTACCTCTACTGCGAGACGGACTCGATCCAGAAGCAGACGGCAACGAAGATA
TATTTGCCGAACGGCGAAGCCAACCGTACTGACCTTGTTGACGTGCTCGGCCTAACGCCGGGTGAGTACG
AGTTCGTGCGTGACACCCCTCCCGAGAACCGGACGTTCCTGATTCGGCGCGGTAACGAGTCGATCAAGGC
GAAGTTCGATCTCTCCGATATGCCCGCGTTCATCCCGGTGCTGTCCTCCAACGACAAGGGCGTGGCGCTC
ATGGACGAAATCATTCGTGAGCTGGAAACCGACGATCCCGAACAGTGGGTGCCGGTGTTTATGGAGCGTG
CGCTCGCCAAGAACACGCACAACCTCAAGCAGAAAGGAGCATGA
 Primer design