SecReT4
Protein ID: 38639491
T4SS name [ID]VirB [211]
Gene symboltrwB
Locus tagpXcB_p22
StrainXanthomonas citri plasmid pXcB (NC_005240)
Repliconplasmid pXcB [GenBank: NC_005240] [Browse all T4SS(s) in this replicon]
Location [Strand]18720..20294 [-]
ProductTrwB
Component typeVirD4
UniProt IDQ7X127
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 3e-126, Aligned region: 127..510
TraG-D_C [PF12696], Evalue: 1.1e-20, Aligned region: 368..490
T4SS-DNA_transf [PF02534], Evalue: 9.4e-20, Aligned region: 285..511
AAA_10 [PF12846], Evalue: 1.4e-09, Aligned region: 140..181
FtsK_SpoIIIE [PF01580], Evalue: 3.3e-05, Aligned region: 118..178
Protein Sequence: 524 a.a.     [Download]
>gi|38639491|ref|NP_942626.1| TrwB [Xanthomonas citri]
MQKHEAEDATLFFGVSLPIAGWLAGTYAANVPLSPFPQALTAALHATPNNPFMVGGVVAGLGLAATTGYL
FHEYGDDGFRGAPYRRWMRGSQMANWHSVKSKVNAANRRENRRRRAEQRGAKDLPPIMIGPMPMPLHLEN
RNTLICASIGAGKSVALESMISSAVKRRDKMAVIDPNGTFYSKFSFPGDTILNPFDRRSSGWTLFNEIKG
VHDFDRMAKSVIPPQIDPSDEQWCAYARDVLADTMRKLVETNNPDQDTLVNLLVREDGEVIRAFLANTDS
QGYFRENAEKAIASIQFMMNKYVRPLRFMTKGDFSLHKWVHDPNAGNLFITWREDMRAAQRPLVATWIDT
ICATILSISDDAQHLSRRLWLFLDELESLGKLESFVPAATKGRKHGLRMAASIQDWAQLDETYGKDAAKT
LLGCFRNYLIFGASNALNADKASEILGKQHVERIQITTNAGGSGGGGRSRHVVASPPEPVVLDSEISNLK
DLGGYVMFAEDFPIAKIKLPYVKYPHRAAAIDIK
 
Nucleotide Sequence: 1575 bp     [Download]
>gi|38639487|ref|NC_005240.1|:c20294-18720 Xanthomonas citri plasmid pXcB, complete sequence
ATGCAGAAGCACGAAGCCGAGGATGCCACGCTGTTCTTTGGCGTTAGTTTGCCGATTGCTGGCTGGCTCG
CCGGCACGTATGCAGCGAATGTGCCGCTGTCACCGTTCCCGCAAGCGCTCACCGCTGCGCTACACGCGAC
GCCGAACAATCCGTTCATGGTTGGCGGGGTTGTGGCCGGGTTGGGACTGGCCGCGACCACCGGGTATCTG
TTCCACGAGTACGGCGACGATGGGTTCCGGGGCGCACCGTATCGCCGCTGGATGCGCGGCTCGCAGATGG
CGAACTGGCACAGCGTAAAGAGCAAGGTCAACGCGGCCAATCGCCGGGAGAATCGCCGGCGACGGGCCGA
ACAGAGGGGCGCGAAGGATTTGCCCCCCATCATGATCGGCCCCATGCCGATGCCGCTGCACCTTGAGAAC
CGTAACACGCTGATTTGCGCGTCCATCGGCGCGGGCAAATCGGTTGCGTTGGAAAGCATGATCTCGTCGG
CCGTGAAACGGCGCGACAAGATGGCCGTGATCGACCCGAACGGGACGTTCTATTCGAAATTCAGCTTTCC
CGGCGACACGATTCTCAACCCGTTTGACCGTCGCTCGTCGGGCTGGACGCTGTTCAACGAGATCAAGGGC
GTGCATGACTTCGACCGGATGGCGAAAAGTGTCATCCCGCCGCAGATCGATCCAAGCGATGAACAGTGGT
GCGCCTATGCGCGTGACGTGCTGGCCGACACCATGCGCAAGCTGGTCGAGACGAACAACCCGGATCAAGA
CACGCTGGTCAACCTGTTGGTGCGCGAGGATGGTGAAGTCATCCGCGCGTTTCTCGCCAACACCGATTCG
CAGGGCTACTTCCGCGAGAACGCCGAGAAGGCCATCGCGTCGATCCAGTTCATGATGAACAAGTACGTGC
GGCCGCTGCGCTTCATGACCAAGGGCGATTTCTCGCTGCATAAGTGGGTGCATGACCCCAACGCCGGCAA
TCTGTTCATCACGTGGCGCGAGGACATGCGGGCCGCGCAGCGCCCGCTTGTGGCGACATGGATCGACACG
ATTTGCGCGACGATTCTCAGTATCTCCGACGACGCGCAACACCTCTCCCGGCGTCTGTGGCTGTTCCTTG
ATGAGCTGGAATCGCTCGGCAAGCTCGAATCGTTCGTGCCAGCGGCGACCAAGGGCCGTAAGCACGGGCT
GCGCATGGCAGCCTCGATACAGGATTGGGCGCAGCTCGATGAGACCTACGGCAAGGATGCGGCCAAGACC
TTGCTCGGCTGCTTCCGTAATTACCTCATCTTTGGCGCGTCGAACGCGCTCAATGCCGACAAGGCGAGCG
AGATTCTTGGCAAGCAGCACGTCGAGCGCATCCAGATTACGACCAACGCAGGGGGAAGCGGTGGAGGCGG
CCGTAGCCGCCATGTTGTCGCCAGTCCACCGGAGCCGGTGGTATTGGACTCGGAAATCTCGAACCTCAAG
GACCTGGGGGGCTACGTCATGTTTGCCGAGGACTTCCCTATTGCGAAGATCAAGCTGCCCTACGTGAAGT
ATCCGCATCGCGCGGCCGCCATCGACATCAAGTGA
 Primer design