SecReT4
Protein ID: 38639492
T4SS name [ID]VirB [211]
Gene symbolvirB10
Locus tagpXcB_p13
StrainXanthomonas citri plasmid pXcB (NC_005240)
Repliconplasmid pXcB [GenBank: NC_005240] [Browse all T4SS(s) in this replicon]
Location [Strand]10164..11384 [+]
ProductVirB10
Component typeVirB10
UniProt IDQ7X126
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.8e-58, Aligned region: 206..385
Protein Sequence: 406 a.a.     [Download]
>gi|38639492|ref|NP_942617.1| VirB10 [Xanthomonas citri]
MSDQTNKPQDDREAAVQAWEKQANASLVADDRKKKMSGIAIAAIAAAALGAVWYMKHDGSEPAKPAGNSE
LSIPERKPVPKLKDQEPASVPAVTSAPAATPASAAQADDPLKAQREQMEMQRREQERRMLEARMKSAIIP
PNSNNQAAASAQPVGDSGDQGPSNAGTLGGGSGERGAQDPNSRFARAVSGNGVAVSKANQIDNLPYKVLQ
GKLSEAVLEPRAISDLPGMVCATVQRDVYGEQDRNKLIPWGSRVCGVYSAEVRKGQDRLFVIWNTVRRPD
GVQVALDSAGADQLGTAGMGGIVDTHFAEIFGMSALLSIIGAGASNAGVSSGDQYNSTAAYRQSVQQAAA
QTSQSVLQPYINIPPTITVPAGSRVRIYVNKDLDFTPIYKDDIDAAKHGDGVTFIP
 
Nucleotide Sequence: 1221 bp     [Download]
>gi|38639487|ref|NC_005240.1|:10164-11384 Xanthomonas citri plasmid pXcB, complete sequence
ATGAGCGATCAGACCAACAAGCCACAGGATGACCGCGAGGCGGCGGTCCAAGCGTGGGAAAAGCAGGCCA
ATGCCTCGTTGGTGGCCGATGATCGCAAGAAGAAGATGAGCGGTATCGCGATTGCTGCCATCGCGGCGGC
AGCCCTCGGTGCGGTCTGGTACATGAAGCACGACGGTAGCGAGCCGGCGAAGCCGGCGGGCAACAGCGAA
CTGAGCATTCCCGAGCGTAAGCCGGTGCCCAAGCTCAAGGACCAGGAACCGGCCAGCGTGCCGGCTGTGA
CTTCCGCGCCGGCCGCAACGCCTGCGAGCGCGGCGCAAGCCGATGACCCGCTGAAGGCCCAACGCGAACA
GATGGAAATGCAGCGTCGGGAACAAGAGCGGCGGATGCTCGAAGCCCGCATGAAGTCGGCCATCATCCCG
CCGAACTCCAACAACCAGGCGGCAGCGTCTGCGCAGCCGGTGGGCGATAGCGGCGACCAAGGGCCATCGA
ATGCCGGCACGCTCGGCGGCGGTAGCGGCGAGCGTGGCGCACAAGACCCGAATTCACGTTTTGCGCGGGC
CGTGTCTGGCAATGGCGTGGCGGTCAGCAAGGCAAATCAAATCGACAACCTGCCCTACAAGGTCTTGCAG
GGCAAGCTCAGCGAGGCCGTGCTTGAACCGCGGGCGATCTCCGATCTGCCCGGCATGGTGTGCGCGACCG
TGCAGCGCGACGTGTACGGCGAGCAAGACCGGAACAAGCTGATTCCGTGGGGTTCGCGGGTGTGCGGCGT
GTACAGCGCCGAAGTGCGCAAGGGGCAAGACCGGCTGTTCGTGATCTGGAACACGGTGCGCCGGCCGGAT
GGCGTGCAAGTGGCGCTGGATAGCGCGGGCGCGGACCAGCTCGGCACGGCCGGCATGGGCGGCATCGTGG
ACACGCATTTTGCCGAGATTTTCGGCATGTCCGCGCTGCTGTCGATCATCGGCGCCGGCGCGTCGAACGC
CGGCGTGAGTTCGGGCGATCAGTACAACTCGACCGCCGCCTATCGGCAATCGGTGCAACAGGCAGCCGCG
CAAACCTCGCAGTCGGTGCTACAGCCGTACATCAATATCCCGCCGACCATCACCGTGCCGGCCGGCTCGC
GCGTTCGCATCTACGTGAACAAAGACCTCGATTTCACACCGATCTACAAGGACGACATCGACGCAGCCAA
GCACGGCGACGGCGTGACGTTCATCCCGTGA
 Primer design