SecReT4
Protein ID: 38639495
T4SS name [ID]VirB [211]
Gene symbolvirB1
Locus tagpXcB_p15
StrainXanthomonas citri plasmid pXcB (NC_005240)
Repliconplasmid pXcB [GenBank: NC_005240] [Browse all T4SS(s) in this replicon]
Location [Strand]12425..13312 [+]
ProductVirB1
Component typeVirB1
UniProt IDQ7X123
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 7.9e-19, Aligned region: 27..163
Protein Sequence: 295 a.a.     [Download]
>gi|38639495|ref|NP_942619.1| VirB1 [Xanthomonas citri]
MAARLLAVVPLFAGAQTPAQPLPFEKLAAECAPDVHPTTLKGVVSTESSWNPYAIGVVGGRLDRQPRGLA
EAVATARELERQGFNFSMGLGQVNRYNLAKYGESYETVFEPCRNLKAGSAILKDCFQRAKAQMGDDQHAL
RAAFSCYYSGNFTRGFRADKAGQPSYVQKVVANATGAAQPIPVVPAVKPESSDGAVVVRPAGRAAGPAKQ
AATPSQWVIFAEGSPQGGQSVAPTDAASAKEPAVKVQLVTPGAAPAVAAAPAERVQTQREAQAVPVQRAT
ANSTQQDAPFVQFVH
 
Nucleotide Sequence: 888 bp     [Download]
>gi|38639487|ref|NC_005240.1|:12425-13312 Xanthomonas citri plasmid pXcB, complete sequence
ATGGCGGCCAGGCTGTTGGCCGTTGTGCCTCTGTTCGCTGGTGCGCAAACGCCGGCACAGCCGCTGCCGT
TTGAAAAGCTGGCCGCCGAGTGCGCCCCGGACGTTCACCCGACCACGCTCAAGGGCGTGGTGAGTACCGA
ATCGTCGTGGAATCCCTACGCGATCGGCGTGGTGGGCGGCCGCCTCGATCGTCAGCCGCGTGGCCTGGCT
GAAGCGGTTGCCACGGCGCGCGAGCTGGAGCGGCAGGGCTTCAATTTCTCGATGGGCTTGGGACAGGTCA
ACCGGTACAACCTCGCCAAGTACGGCGAAAGCTACGAGACCGTGTTCGAGCCGTGCCGCAATCTCAAGGC
GGGCAGCGCGATCCTCAAAGACTGCTTCCAGCGCGCCAAGGCGCAGATGGGTGACGATCAGCACGCCTTG
CGGGCCGCGTTCAGTTGCTACTACTCGGGCAACTTCACGCGCGGTTTTCGAGCGGACAAAGCCGGCCAGC
CGAGCTATGTGCAGAAGGTCGTAGCGAACGCGACGGGGGCGGCTCAGCCGATCCCCGTTGTGCCGGCCGT
GAAGCCCGAAAGCTCCGATGGTGCCGTGGTCGTTCGCCCTGCTGGCCGCGCGGCAGGGCCGGCGAAACAG
GCGGCGACGCCGAGCCAATGGGTGATCTTCGCGGAGGGATCGCCGCAGGGCGGCCAGTCGGTCGCACCCA
CGGATGCGGCGTCGGCCAAGGAGCCGGCCGTCAAGGTCCAGCTCGTGACGCCGGGCGCTGCGCCGGCGGT
TGCCGCAGCGCCTGCCGAGCGAGTGCAGACGCAGCGCGAAGCACAAGCCGTCCCCGTGCAACGGGCAACG
GCAAACAGCACTCAGCAGGACGCGCCCTTCGTGCAGTTCGTGCATTGA
 Primer design