SecReT4
Protein ID: 38639496
T4SS name [ID]VirB [211]
Gene symbolvirB6
Locus tagpXcB_p10
StrainXanthomonas citri plasmid pXcB (NC_005240)
Repliconplasmid pXcB [GenBank: NC_005240] [Browse all T4SS(s) in this replicon]
Location [Strand]7817..8683 [+]
ProductVirB6
Component typeVirB6
UniProt IDQ7X122
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.2e-40, Aligned region: 40..263
Protein Sequence: 288 a.a.     [Download]
>gi|38639496|ref|NP_942614.1| VirB6 [Xanthomonas citri]
MATMTIEGMIGATDGVTQSFLTQTYPALASAISTPIYLVAVLYWAVYGYKIYAGYEPMRWNAVLSKAFMT
TAVFSSLNWGGLGQSIYGFFTSFMEGAASTIMSGQSTASMLDALYNNVGQVSALMQKVSWYQFGMILQGF
GLFIVNCILFILALVYMTIAKFGLAITMVLLPIFVGFFFFEQTRQWAMNWLSKMLNFCFIYILVIAIVRF
GFLAFGDAIDEAGKAASVTDAMLIHVQQVAYLYIVEGVLIIFMLQVKGWAAALAGGASVQGVSLLMMVAR
MFTKGAGK
 
Nucleotide Sequence: 867 bp     [Download]
>gi|38639487|ref|NC_005240.1|:7817-8683 Xanthomonas citri plasmid pXcB, complete sequence
ATGGCGACAATGACCATTGAGGGAATGATTGGTGCGACCGATGGCGTCACTCAATCGTTCCTGACGCAAA
CCTATCCAGCCCTCGCGAGCGCGATTTCTACGCCGATCTATTTGGTGGCGGTGCTGTATTGGGCGGTATA
CGGCTACAAGATATATGCCGGATACGAGCCGATGAGATGGAATGCGGTGCTCTCGAAAGCCTTCATGACC
ACAGCCGTGTTTTCGTCCTTGAATTGGGGCGGCCTAGGGCAGAGCATCTACGGATTTTTCACGTCGTTCA
TGGAGGGGGCGGCGTCAACGATCATGTCCGGGCAGTCCACGGCCTCGATGCTAGACGCTCTGTACAACAA
CGTTGGTCAAGTGTCGGCGCTAATGCAAAAAGTGAGCTGGTATCAGTTCGGCATGATTTTGCAGGGCTTT
GGCCTCTTCATCGTCAACTGCATCCTGTTTATTCTCGCGCTCGTCTACATGACGATTGCCAAGTTCGGCT
TGGCTATCACGATGGTCCTGCTGCCGATCTTCGTCGGGTTTTTCTTCTTCGAGCAAACGCGGCAGTGGGC
CATGAACTGGCTGAGCAAGATGTTGAATTTTTGCTTCATTTACATCTTGGTCATCGCCATCGTTCGCTTC
GGCTTCCTTGCGTTTGGCGATGCGATTGACGAGGCCGGCAAAGCAGCGAGTGTGACGGATGCGATGCTTA
TTCACGTCCAGCAAGTTGCCTACCTCTACATCGTCGAAGGCGTCTTGATCATTTTCATGCTGCAAGTCAA
AGGTTGGGCCGCAGCACTTGCCGGTGGTGCATCTGTGCAGGGCGTGTCGTTGTTGATGATGGTAGCCCGG
ATGTTCACCAAAGGAGCTGGCAAATGA
 Primer design