SecReT4
Protein ID: 38639499
T4SS name [ID]VirB [211]
Gene symbolvirB9
Locus tagpXcB_p12
StrainXanthomonas citri plasmid pXcB (NC_005240)
Repliconplasmid pXcB [GenBank: NC_005240] [Browse all T4SS(s) in this replicon]
Location [Strand]9379..10167 [+]
ProductVirB9
Component typeVirB9
UniProt IDQ7X119
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.3e-65, Aligned region: 37..242
Protein Sequence: 262 a.a.     [Download]
>gi|38639499|ref|NP_942616.1| VirB9 [Xanthomonas citri]
MKFNAIALAVALIAGTSISLASVPAHAAKSPHALVTDDRVKQVPYDPNQVYEIVGTYGYQTSIEFANDET
VKVVTLGDSIAWQTVPYQNRLFLKPVEPNAATNLTVITDKRTYYFKLTSSKSQAAMTFLVRFVYPNSNVK
TYAGAGSAQRMSNGFDPAKLNLGYGTSGNKTAIPLKRAFDDGQFTYFMFDQNAEIPSVYTVGPDGTETIV
NTRREGQYLVVERTASLFTLRNGNAHLCVQNNANPYKRAVSGLVNTDGGQLI
 
Nucleotide Sequence: 789 bp     [Download]
>gi|38639487|ref|NC_005240.1|:9379-10167 Xanthomonas citri plasmid pXcB, complete sequence
ATGAAATTCAACGCGATTGCTCTCGCTGTTGCCCTCATTGCTGGCACGTCGATTTCGCTGGCCTCGGTGC
CGGCCCACGCGGCGAAGTCGCCGCATGCGTTGGTGACGGATGATCGCGTCAAACAAGTGCCGTATGACCC
GAATCAGGTCTACGAGATCGTTGGCACGTATGGCTACCAGACCTCCATCGAGTTCGCCAATGACGAAACG
GTCAAGGTCGTGACGTTGGGCGATTCGATTGCATGGCAAACCGTGCCGTACCAGAACCGCCTTTTCCTCA
AGCCGGTGGAGCCGAACGCAGCCACGAACCTGACCGTGATTACCGATAAGCGCACGTACTACTTCAAGCT
GACTAGCTCCAAGAGCCAAGCGGCGATGACGTTCCTGGTCCGCTTCGTCTATCCGAACTCGAACGTGAAG
ACATACGCCGGCGCGGGCAGCGCGCAGCGCATGAGCAACGGGTTCGATCCGGCCAAGCTCAACCTTGGCT
ACGGCACGTCGGGAAACAAGACGGCCATCCCGTTGAAGCGCGCTTTCGATGATGGCCAGTTCACCTATTT
CATGTTCGACCAGAACGCAGAAATCCCTTCGGTGTACACCGTTGGCCCGGACGGCACAGAGACCATCGTC
AACACGCGACGCGAGGGGCAATACCTGGTGGTTGAACGCACGGCAAGCCTGTTCACGCTGCGCAATGGCA
ACGCTCACCTCTGCGTGCAAAACAACGCCAATCCCTACAAGCGCGCTGTGAGTGGCCTGGTGAACACTGA
CGGGGGGCAACTGATATGA
 Primer design