SecReT4
Protein ID: 38639502
T4SS name [ID]VirB [211]
Gene symbolvirB11
Locus tagpXcB_p14
StrainXanthomonas citri plasmid pXcB (NC_005240)
Repliconplasmid pXcB [GenBank: NC_005240] [Browse all T4SS(s) in this replicon]
Location [Strand]11395..12414 [+]
ProductVirB11
Component typeVirB11
UniProt IDQ7X116
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.8e-45, Aligned region: 13..322
Protein Sequence: 339 a.a.     [Download]
>gi|38639502|ref|NP_942618.1| VirB11 [Xanthomonas citri]
MSQIASFRTKLSLLADHLDDKQVTEIQVNKPGELWLRKKDAYYAEQIEVPGLTYQLLSSLAEVTASFKSL
DVDRESPILSAEIPVNLDDGVPDFERGTYRTEMILPPVVPEGTIAMTIRKQSLVRMSLPKYKEQGAFRFV
NSDVTDEPYSDARLLELYRAKEWDQFLRGAVLAHKNIVISAGTYCGKTTCLNALVQEIPAHERSSRLKTH
GKSSRRNQTACAFPTRAISIGASCRDAHNVASLVHATHPRPVIMGEIRGPEAVEFLNMLNTGHKGSLTTI
HTDSPAEMYDRFGELMDGHTSMTRARVIARVKRRIDVVVQWKYTERNGRYISEIIYAGA
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|38639487|ref|NC_005240.1|:11395-12414 Xanthomonas citri plasmid pXcB, complete sequence
ATGTCGCAGATTGCCTCCTTCCGTACCAAGCTCTCCTTGCTGGCCGACCATCTCGATGACAAGCAGGTCA
CCGAGATTCAGGTCAACAAGCCGGGAGAGCTCTGGCTGCGAAAGAAAGACGCGTACTACGCCGAGCAAAT
TGAAGTGCCGGGGCTGACATACCAGTTGCTTTCGTCACTGGCCGAGGTCACGGCGTCTTTCAAGAGTCTG
GACGTTGATCGGGAGAGTCCGATCCTCTCGGCCGAGATTCCGGTGAATCTCGATGACGGTGTTCCAGACT
TCGAGCGCGGAACGTACCGCACTGAAATGATCCTTCCGCCGGTCGTACCGGAGGGCACCATCGCGATGAC
GATTCGTAAGCAATCGCTGGTTCGCATGAGCCTGCCGAAATACAAGGAACAGGGCGCTTTCCGATTCGTC
AATAGCGACGTGACCGATGAGCCGTATTCCGATGCTCGCTTGCTGGAGCTGTATCGCGCGAAAGAGTGGG
ACCAGTTCCTGCGCGGGGCAGTGTTGGCCCACAAGAACATTGTCATATCGGCCGGGACGTACTGCGGCAA
GACCACGTGCCTCAATGCGTTGGTGCAGGAAATCCCCGCGCACGAGCGATCGTCACGATTGAAGACTCAC
GGGAAATCGAGCCGGCGCAACCAAACTGCGTGCGCCTTTCCTACGCGCGCCATCAGCATCGGGGCAAGCT
GCCGTGACGCCCACAACGTTGCTTCGCTCGTGCATGCGACTCACCCCCGACCGGTCATCATGGGCGAGAT
TCGCGGCCCGGAAGCGGTTGAGTTCTTGAACATGCTCAACACGGGCCACAAGGGGTCGCTCACGACGATT
CACACCGATTCGCCGGCCGAAATGTATGACCGCTTTGGCGAGTTGATGGACGGTCACACGTCGATGACGC
GCGCGAGGGTCATCGCGCGCGTCAAGCGACGAATCGACGTTGTTGTGCAGTGGAAATACACCGAGCGCAA
CGGTCGCTACATTTCGGAGATCATCTATGCAGGTGCGTGA
 Primer design