SecReT4
Protein ID: 38639503
T4SS name [ID]VirB [211]
Gene symbolvirB8
Locus tagpXcB_p11
StrainXanthomonas citri plasmid pXcB (NC_005240)
Repliconplasmid pXcB [GenBank: NC_005240] [Browse all T4SS(s) in this replicon]
Location [Strand]8680..9354 [+]
ProductVirB8
Component typeVirB8
UniProt IDQ7X115
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 7.5e-40, Aligned region: 23..220
Protein Sequence: 224 a.a.     [Download]
>gi|38639503|ref|NP_942615.1| VirB8 [Xanthomonas citri]
MKFGKKTFLGDNETQAAQLGGSNKLKQERNRAYLLIGLLLFVVGGMASAVTVLANVHTVIPVVSVIDANG
HVVKQQVVNKETITGQESFVQSQVYDFIMYCNTFDPDWRQRFADLCRLHSTQAVAGQYDAETSPDNPNNL
YYQLGQGGRRYPKITGITSLGKDAYQVSFQSITEKAGSPPKTDYYTALVRYTFTFKPLALGDRWENALGY
ATTAYRKDQELSRQ
 
Nucleotide Sequence: 675 bp     [Download]
>gi|38639487|ref|NC_005240.1|:8680-9354 Xanthomonas citri plasmid pXcB, complete sequence
ATGAAATTCGGCAAGAAGACTTTTTTGGGCGACAACGAGACGCAGGCGGCCCAATTGGGCGGCTCGAACA
AGCTCAAGCAAGAACGCAACCGCGCGTATCTGCTCATCGGGTTGCTGCTGTTCGTCGTCGGCGGCATGGC
AAGCGCGGTCACGGTGCTCGCCAACGTTCACACGGTCATTCCCGTGGTATCGGTCATCGACGCGAACGGC
CATGTGGTGAAACAGCAGGTGGTCAACAAGGAAACGATCACGGGGCAGGAAAGCTTCGTTCAGAGTCAGG
TGTACGACTTCATCATGTATTGCAACACGTTCGACCCGGACTGGCGGCAGCGGTTTGCCGACCTCTGCCG
GCTGCACTCGACGCAAGCGGTGGCAGGCCAGTACGACGCGGAAACCAGCCCCGACAACCCGAACAACCTG
TATTACCAGCTCGGGCAGGGCGGTCGGCGCTACCCGAAAATCACGGGCATTACGTCGCTCGGCAAGGATG
CGTATCAGGTGTCGTTCCAGTCGATTACGGAGAAGGCGGGGAGCCCGCCGAAGACCGACTACTACACCGC
GCTCGTCCGCTACACCTTCACGTTCAAACCCCTTGCACTTGGCGACCGCTGGGAAAACGCGCTGGGCTAC
GCCACAACGGCCTACCGCAAGGACCAAGAGCTGAGCCGCCAGTAA
 Primer design