SecReT4
Protein ID: 38639504
T4SS name [ID]VirB [211]
Gene symbolvirB5
Locus tagpXcB_p07
StrainXanthomonas citri plasmid pXcB (NC_005240)
Repliconplasmid pXcB [GenBank: NC_005240] [Browse all T4SS(s) in this replicon]
Location [Strand]6498..7163 [+]
ProductVirB5
Component typeVirB5
UniProt IDQ7X114
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 2.7e-44, Aligned region: 26..210
Protein Sequence: 221 a.a.     [Download]
>gi|38639504|ref|NP_942611.1| VirB5 [Xanthomonas citri]
MTMKKTLVALALAASLGASVPAFATGIPTFDAATVLQLQQQFQQLQEQYKTLKDQYAAVTGSYGRGQMGL
SDSISSASVVPGSWQEVVAQQQSGAFGSKQAAYEKLINTMPKDLFANPQAQDATTYKMSTDAVRAALAGG
DSLYAEVQTHLNNLARMSQQVDTTVNIKDAQDLQNRIAGENGMMQSAMAKLNAMNMNLQANMVNQQNQAT
AANHNFYQWKK
 
Nucleotide Sequence: 666 bp     [Download]
>gi|38639487|ref|NC_005240.1|:6498-7163 Xanthomonas citri plasmid pXcB, complete sequence
ATGACCATGAAAAAGACCCTCGTCGCCCTCGCGCTGGCCGCTTCCCTCGGCGCATCGGTGCCGGCCTTCG
CTACCGGCATCCCGACCTTCGATGCGGCAACGGTGCTCCAGTTGCAACAACAGTTCCAGCAGTTGCAGGA
GCAATACAAAACGCTCAAGGACCAGTACGCCGCCGTCACGGGCAGCTATGGCCGTGGGCAAATGGGTCTG
AGCGATTCCATCAGCTCGGCCTCGGTGGTGCCCGGTTCGTGGCAGGAAGTCGTCGCGCAGCAACAGAGTG
GGGCGTTCGGGTCGAAGCAGGCCGCCTACGAGAAGCTCATCAACACGATGCCGAAAGACCTGTTCGCCAA
TCCGCAGGCCCAGGACGCCACGACGTACAAGATGAGTACCGATGCCGTGCGGGCTGCGTTGGCCGGTGGC
GACTCGTTGTATGCCGAAGTGCAGACGCACCTCAACAATCTGGCGCGCATGAGCCAGCAGGTCGATACGA
CGGTGAACATCAAGGACGCTCAGGACTTGCAGAACCGCATTGCGGGCGAGAACGGGATGATGCAAAGCGC
GATGGCGAAGCTGAACGCGATGAACATGAACCTGCAAGCCAACATGGTGAACCAGCAGAACCAAGCGACG
GCTGCAAACCATAACTTCTACCAGTGGAAGAAATAA
 Primer design