SecReT4
Protein ID: 38639508
T4SS name [ID]VirB [211]
Gene symbolvirB2
Locus tagpXcB_p04
StrainXanthomonas citri plasmid pXcB (NC_005240)
Repliconplasmid pXcB [GenBank: NC_005240] [Browse all T4SS(s) in this replicon]
Location [Strand]3172..3549 [+]
ProductVirB2
Component typeVirB2
UniProt IDQ7X110
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.8e-21, Aligned region: 23..115
Protein Sequence: 125 a.a.     [Download]
>gi|38639508|ref|NP_942608.1| VirB2 [Xanthomonas citri]
MEKNEAIEKDTAGGPRKGDKVDKALGLTANALVMALVFLPQLAYAQDAGGTFGGITAFLKSITQLLIYEW
GYYIGIITLAIQGYRWKSGRIDLMTLGGWGLGIGLVFFAPNIVSDLKARSSGSIQ
 
Nucleotide Sequence: 378 bp     [Download]
>gi|38639487|ref|NC_005240.1|:3172-3549 Xanthomonas citri plasmid pXcB, complete sequence
ATGGAAAAGAACGAAGCGATTGAAAAGGACACGGCAGGAGGCCCGCGCAAGGGCGACAAGGTAGACAAGG
CACTCGGTCTGACCGCGAACGCCCTCGTGATGGCCCTCGTCTTTCTTCCGCAGCTCGCATATGCACAAGA
CGCCGGTGGCACGTTTGGCGGGATCACCGCCTTCCTGAAGTCAATCACGCAATTGCTCATTTATGAGTGG
GGCTACTACATCGGCATCATCACCTTGGCGATCCAAGGGTATCGTTGGAAGTCGGGCCGCATCGACCTGA
TGACGCTCGGCGGTTGGGGCCTCGGTATCGGCCTTGTGTTCTTCGCGCCAAACATCGTTTCCGACCTCAA
GGCGCGTTCCTCTGGTTCGATCCAATGA
 Primer design