SecReT4
Protein ID: 38639509
T4SS name [ID]VirB [211]
Gene symbolvirB3
Locus tagpXcB_p05
StrainXanthomonas citri plasmid pXcB (NC_005240)
Repliconplasmid pXcB [GenBank: NC_005240] [Browse all T4SS(s) in this replicon]
Location [Strand]3546..3845 [+]
ProductVirB3
Component typeVirB3
UniProt IDQ7X109
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 7.8e-16, Aligned region: 1..92
Protein Sequence: 99 a.a.     [Download]
>gi|38639509|ref|NP_942609.1| VirB3 [Xanthomonas citri]
MSAEEQFHDEGESLVAAMTRPTMVGGLTLASLAMSFYFPGMAALITRSLWAAALIPVLLLISYLVCLKDV
YLFDIMSAATHLKTCPNKRFWGCRRYAPR
 
Nucleotide Sequence: 300 bp     [Download]
>gi|38639487|ref|NC_005240.1|:3546-3845 Xanthomonas citri plasmid pXcB, complete sequence
ATGAGTGCCGAGGAGCAATTCCACGATGAAGGGGAGTCGCTCGTCGCTGCGATGACCCGCCCCACGATGG
TGGGCGGGTTGACGCTGGCAAGTCTTGCGATGAGCTTCTATTTCCCCGGCATGGCCGCGTTAATCACGCG
ATCACTTTGGGCGGCGGCATTGATTCCGGTCTTACTGCTGATCAGTTATCTGGTCTGCCTGAAAGACGTG
TACCTGTTCGACATCATGTCGGCTGCAACCCATTTGAAAACGTGTCCGAACAAACGTTTTTGGGGATGCC
GACGCTATGCGCCTCGTTGA
 Primer design