SecReT4
Protein ID: 38639510
T4SS name [ID]VirB [211]
Gene symbolvirB7
Locus tagpXcB_p08
StrainXanthomonas citri plasmid pXcB (NC_005240)
Repliconplasmid pXcB [GenBank: NC_005240] [Browse all T4SS(s) in this replicon]
Location [Strand]7229..7429 [+]
ProductVirB7
Component typeVirB7
UniProt IDQ7X108
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 66 a.a.     [Download]
>gi|38639510|ref|NP_942612.1| VirB7 [Xanthomonas citri]
MFLKVVTAPAWVPLWLMKKGVRLFAVLVLGAVLAGCATTSNQFDKSPCACDFKQLNTGNYGSKANA
 
Nucleotide Sequence: 201 bp     [Download]
>gi|38639487|ref|NC_005240.1|:7229-7429 Xanthomonas citri plasmid pXcB, complete sequence
ATGTTTTTGAAAGTTGTTACTGCACCGGCATGGGTTCCGTTGTGGCTTATGAAAAAGGGCGTTCGTCTTT
TCGCCGTGTTGGTCCTTGGGGCGGTTCTGGCCGGCTGCGCAACTACGTCGAACCAGTTCGACAAGTCGCC
GTGTGCGTGCGACTTCAAGCAACTCAACACCGGTAACTATGGGAGCAAAGCAAATGCCTAA
 Primer design