SecReT4
Protein ID: 39935294
T4SS name [ID]Trb [333]
Gene symboltrbG1
Locus tagRPA2225
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]2522927..2523928 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ6N7N2
KEGG IDrpa:RPA2225
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.8e-70, Aligned region: 102..326
Protein Sequence: 333 a.a.     [Download]
>gi|39935294|ref|NP_947570.1| conjugal transfer protein TrbG [Rhodopseudomonas palustris CGA009]
MRLIPVTTIMLASVSLAACSHTWKPPEITYDPIAAPQPATPEVEPPKPVEIVQIPTPLPLPGQLQRIPPP
PSQTPEPADPRARVEAANGAARIQPSRSGYFNAVQVYPYSDGALYQVYTAPGQVTDIALEAGEQLVGTGP
VAAGDTVRWIIGDTESGSGPTRRIHILVKPTRADLQTNLVINTDRRTYHLELRAAERTYMASVSWSYPQD
QLIALRRQNSQAQAAETAATSPLPALESLNFRYRIEGDNPAWRPVRAFDDGRQVFIEFPTGIAQGEMPPL
WIIGAQGNAELVNYRVRGRYMVVDRLFGGAELRLGGDRQRRVRIVRIDARPAS
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c2523928-2522927 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGCGACTGATCCCCGTTACAACCATCATGCTTGCGTCGGTATCGCTCGCGGCCTGTTCGCATACCTGGA
AGCCGCCGGAGATCACCTATGATCCTATCGCGGCCCCGCAGCCGGCGACGCCCGAGGTCGAGCCGCCCAA
GCCGGTCGAAATCGTGCAGATTCCGACGCCCTTGCCTCTGCCAGGCCAACTCCAACGCATTCCACCGCCC
CCCTCGCAGACACCGGAGCCGGCCGACCCGCGCGCACGGGTGGAAGCCGCCAATGGCGCGGCCCGCATTC
AGCCAAGCCGGTCCGGCTATTTCAACGCGGTTCAGGTCTATCCCTATTCGGATGGCGCGCTGTACCAAGT
GTACACAGCGCCGGGCCAGGTGACCGACATCGCCCTCGAAGCGGGTGAGCAACTGGTCGGCACAGGACCT
GTGGCCGCCGGCGACACGGTGCGCTGGATCATCGGTGATACGGAAAGCGGCAGCGGGCCGACCCGAAGGA
TCCATATCCTCGTCAAGCCGACGCGCGCCGATCTTCAGACCAACTTGGTGATCAATACCGATCGCCGGAC
GTATCATCTCGAACTGCGGGCGGCCGAGCGCACCTACATGGCCAGTGTTTCCTGGTCTTATCCGCAAGAC
CAGCTCATCGCCCTACGCCGCCAGAACTCACAAGCGCAGGCCGCGGAGACGGCAGCGACCTCGCCGTTGC
CGGCGCTGGAGTCGCTGAACTTTCGCTACCGGATCGAAGGCGACAATCCGGCCTGGCGACCGGTTAGGGC
CTTCGACGACGGGCGGCAGGTCTTCATCGAGTTTCCAACTGGCATTGCGCAGGGCGAGATGCCCCCACTC
TGGATCATCGGCGCACAAGGCAATGCCGAACTGGTGAACTACCGTGTGCGAGGCCGCTACATGGTCGTTG
ACCGTCTCTTTGGCGGCGCTGAGCTTCGCCTGGGCGGAGACCGCCAACGGCGCGTCCGTATCGTTCGCAT
TGACGCGAGGCCGGCATCGTGA
 Primer design