SecReT4
Protein ID: 39935296
T4SS name [ID]Trb [333]
Gene symboltrbL
Locus tagRPA2227
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]2524611..2525909 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ6N7N0
KEGG IDrpa:RPA2227
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-51, Aligned region: 37..261
Protein Sequence: 432 a.a.     [Download]
>gi|39935296|ref|NP_947572.1| conjugal transfer protein TrbL [Rhodopseudomonas palustris CGA009]
MQGTGVIDRFLEVFTRYIDSGFGLLQGEVAWLASTLIVIDVTLAALFWAWGADEDILARLVKKTLFVGAF
AFIIGNWNTLARIVFESFAGLGLKASGTGLTAAEFLRPGRVAQVGFDAGRPILESISGLMGYISFFENFI
QIVVLLLAWAIVLLSFFILAIQLFISLIEFKLATLCGFVLVPFGLFNKTAFMAERVLGLVISSGVKVLVL
AVVVGIGSTLFGEFTQGFQAQPTIEDAMALVLAALSLLGLGIFGPSIANGIVSGGPQLGAGAAVGTGLAA
GGALLAGAAGARMAGGAAMAAVRGGASVAGGASTAYQLGSAAKGGSVAGGLSGVAQAGASAAASPLRRAA
AEMGQRYQAGGRAAFEAMGGKVTGGTDASPANDAGSASGEPAWAKSMRRRQSAAHGIQTAIHAVRAGDGG
GAGSSVSIREGE
 
Nucleotide Sequence: 1299 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c2525909-2524611 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGCAGGGCACCGGGGTCATCGACCGCTTTCTGGAAGTCTTTACCCGCTATATCGATAGCGGCTTTGGCT
TGCTTCAGGGCGAAGTCGCGTGGTTGGCCTCAACCCTTATCGTCATCGACGTAACGCTCGCTGCGCTGTT
TTGGGCCTGGGGTGCGGACGAGGATATCCTCGCCCGCCTGGTCAAGAAGACCCTTTTCGTGGGTGCGTTC
GCCTTCATTATCGGCAACTGGAACACGCTGGCCCGCATCGTCTTTGAAAGCTTTGCGGGGCTCGGGCTGA
AGGCATCGGGCACAGGGCTGACGGCTGCGGAGTTTCTTCGCCCCGGTCGCGTTGCCCAAGTCGGCTTCGA
TGCCGGCAGGCCCATCCTGGAGTCCATCTCCGGGCTGATGGGCTACATCAGCTTCTTCGAGAATTTCATC
CAGATCGTCGTCCTGCTGCTGGCCTGGGCGATCGTGCTGCTGTCTTTCTTCATCCTCGCCATCCAGCTCT
TCATCAGCTTGATCGAGTTCAAGCTCGCGACCTTATGCGGCTTCGTGCTCGTGCCCTTTGGCCTGTTCAA
CAAGACCGCGTTCATGGCTGAACGAGTGCTTGGTCTCGTGATCAGTTCAGGCGTGAAGGTGCTGGTGCTC
GCCGTTGTCGTCGGCATCGGATCGACGTTGTTCGGCGAGTTCACGCAAGGTTTTCAGGCCCAGCCCACAA
TCGAAGACGCGATGGCGCTGGTGCTTGCTGCGCTGTCGCTGCTCGGCCTTGGCATTTTTGGCCCCTCGAT
CGCCAATGGCATCGTCTCGGGCGGCCCGCAGCTTGGCGCCGGGGCAGCCGTTGGCACTGGACTGGCTGCC
GGCGGCGCGCTCCTTGCTGGCGCAGCCGGCGCGCGCATGGCGGGCGGTGCGGCGATGGCGGCCGTGCGGG
GCGGAGCCAGTGTCGCTGGCGGCGCTTCGACGGCCTATCAACTTGGAAGCGCCGCCAAAGGGGGCAGCGT
TGCGGGCGGACTATCCGGCGTCGCGCAAGCCGGGGCTTCCGCAGCGGCCTCGCCGCTCCGCAGAGCAGCC
GCTGAGATGGGGCAGCGCTACCAAGCCGGTGGCCGGGCGGCGTTCGAAGCCATGGGCGGCAAAGTCACCG
GAGGGACCGACGCCAGCCCGGCCAACGATGCGGGCTCCGCCTCCGGGGAGCCCGCCTGGGCCAAATCGAT
GCGTCGACGCCAATCAGCCGCGCACGGCATCCAGACCGCCATCCATGCCGTCCGTGCCGGCGATGGAGGC
GGCGCAGGCTCTTCTGTCAGCATTCGAGAGGGTGAATGA
 Primer design