SecReT4
Protein ID: 39935301
T4SS name [ID]Trb [333]
Gene symboltrbC1
Locus tagRPA2232
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]2529721..2530038 [-]
Productconjugal transfer protein; TrbC
Component typeTrbC
UniProt IDQ6N7M5
KEGG IDrpa:RPA2232
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.9e-24, Aligned region: 4..95
Protein Sequence: 105 a.a.     [Download]
>gi|39935301|ref|NP_947577.1| conjugal transfer protein; TrbC [Rhodopseudomonas palustris CGA009]
MTMFRRCLTGAATFALLAITTAPAYAAGSNMPWEAPLQSILESIQGPVAKIIAVMIIIVTGLTLAFGDTS
GGARKMVQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 318 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c2530038-2529721 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGACCATGTTCCGTCGCTGCTTGACCGGCGCAGCAACCTTCGCGCTGCTCGCGATCACAACCGCACCTG
CCTACGCCGCCGGCTCCAACATGCCGTGGGAGGCGCCGCTCCAGTCGATCCTGGAGTCAATTCAGGGACC
GGTCGCCAAAATCATCGCGGTGATGATCATCATCGTCACCGGGCTCACGCTCGCTTTTGGCGACACCTCG
GGCGGTGCTCGCAAGATGGTCCAGATCGTCTTCGGGCTTTCGATCGCCTTCGCGGCCAGCTCGTTTTTCC
TGTCCTTCTTCTCGTTCGGCGGTGGGGCGCTGGTCTGA
 Primer design