SecReT4
Protein ID: 39937175
T4SS name [ID]Trb [334]
Gene symboltrbI2
Locus tagRPA4115
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]4658541..4659776 [-]
Productconjugal transfer protein trbI
Component typeTrbI
UniProt IDQ6N2D5
KEGG IDrpa:RPA4115
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 8.4e-66, Aligned region: 223..402
Protein Sequence: 411 a.a.     [Download]
>gi|39937175|ref|NP_949451.1| conjugal transfer protein trbI [Rhodopseudomonas palustris CGA009]
MTGDPRQDVASDAFRPASDPVAAFQIRPERPRVTRLSRKVLMAGTGIALVAVSGAVFWALQNNRHRADAP
EELYSTEHRTKADGLSGLPRDYAGIPRQATPLGPPLPGDLGRPMLNAGAAANTVIPAAPAADPEAQRRGQ
EIEAARLSRLFASTNTRELSSITPTPPSATPPDASAVLNPLPQPPADSTFAQNGQDRKLAFINASVDRRT
TSPDRLAAPASPYVVQAGTVIPGALITGIRSDLPGLITAQVSENVYDSPSGKFLLIPQGARLIGQYDSQV
AFGQSRVLLVWTRLIMPNGKSIVLERQPGADTAGYSGLEDDVDNHWGALFKAAMLSTLLSVGSEVGTSGS
EDEVVQAIRRGSSQSFNQVGQRVVSRNLDIQPTLTIRPGFPVRVIVNRDLVLAPYNLEAPR
 
Nucleotide Sequence: 1236 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c4659776-4658541 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGACTGGCGACCCGCGACAGGACGTCGCCTCCGATGCGTTTCGGCCAGCCAGCGATCCGGTTGCTGCGT
TTCAAATCCGACCAGAGCGACCGAGGGTGACGCGGCTCTCGCGCAAGGTGCTGATGGCCGGTACCGGGAT
TGCGCTGGTGGCGGTGTCCGGCGCGGTGTTCTGGGCGTTGCAGAACAATCGCCATCGTGCGGACGCTCCC
GAGGAGCTCTACAGCACGGAGCATCGCACTAAGGCCGATGGATTGTCCGGGCTGCCGCGGGATTACGCCG
GCATCCCGCGCCAAGCGACGCCGCTCGGCCCGCCGTTGCCCGGCGATCTCGGCCGGCCCATGCTCAACGC
CGGCGCTGCAGCGAACACGGTCATTCCAGCAGCTCCCGCGGCGGATCCGGAGGCGCAACGGCGGGGCCAA
GAGATCGAGGCGGCGCGGTTGAGCCGGTTGTTTGCATCGACCAACACCCGAGAATTGTCTTCGATCACGC
CGACTCCGCCATCGGCAACACCACCCGACGCCAGCGCAGTGTTGAACCCCCTTCCTCAACCGCCGGCCGA
TTCGACCTTCGCGCAGAACGGCCAGGACCGGAAACTCGCCTTCATCAACGCCTCGGTCGATCGGCGGACG
ACAAGCCCAGACCGGCTGGCAGCTCCGGCCTCGCCTTACGTGGTGCAGGCCGGCACCGTCATTCCCGGCG
CGCTGATCACCGGCATCCGCTCGGACTTGCCGGGCCTGATCACCGCCCAGGTCTCGGAAAACGTCTATGA
CAGCCCGAGCGGCAAGTTTCTTCTGATTCCGCAAGGCGCGCGGCTGATCGGCCAATACGACAGCCAGGTC
GCTTTCGGCCAGTCCCGCGTCCTCTTGGTCTGGACGCGGCTGATCATGCCGAACGGCAAATCGATCGTGC
TGGAGCGTCAGCCCGGCGCCGACACCGCCGGGTATTCGGGACTGGAGGACGACGTCGATAACCATTGGGG
TGCGCTGTTCAAGGCGGCGATGCTCTCGACGCTGCTCAGCGTGGGCTCCGAAGTCGGCACCAGCGGTAGC
GAGGACGAAGTCGTCCAGGCGATCCGCCGTGGCAGCTCACAGAGCTTCAATCAGGTCGGGCAACGCGTCG
TCAGCCGCAACCTCGATATCCAACCCACGCTCACGATCCGTCCCGGATTCCCGGTCCGTGTGATCGTCAA
CCGCGACCTGGTGCTGGCGCCATACAATCTGGAGGCGCCAAGATGA
 Primer design