SecReT4
Protein ID: 39937176
T4SS name [ID]Trb [334]
Gene symboltrbG2
Locus tagRPA4116
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]4659776..4660816 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ6N2D4
KEGG IDrpa:RPA4116
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.4e-68, Aligned region: 119..341
Protein Sequence: 346 a.a.     [Download]
>gi|39937176|ref|NP_949452.1| conjugal transfer protein TrbG [Rhodopseudomonas palustris CGA009]
MNSRFLNNIMPAPHPLARTSPVRAASALLLMSASMLAGCSHLQKPPEIALDDPAEPAVLLGDPPAPVQVV
ELAKPLPLPGQLKPLARGKPTPEAKDPAVRVNQANAAARVQPVRNGFINAVQVYPFTSGALYQVYAAPGQ
ITDVALQAGEQLTGSGPVAAGDTVRWIIGDTESETGASKKVHILIKPTRPDLVTNLVINTDRRTYFLELR
STEKTYMASVSWQYPEDQLIALRRHNAAALTAAPIDEGIEVSKLRFRYAITGDNPPWRPLSAFDDGSKVY
IEMPRGIAQGEAPPLFVIGPEGDGQLVNYRVRQNYYIVDRLFGAAELRLGGDHQQTVRISRTDGRL
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c4660816-4659776 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGAATTCGCGTTTCCTGAACAACATTATGCCCGCTCCGCACCCGCTCGCCCGGACGTCGCCAGTGAGGG
CCGCGTCGGCGTTGCTGCTGATGTCCGCTTCGATGCTTGCCGGCTGCTCGCATCTCCAAAAGCCGCCGGA
AATCGCGCTCGACGATCCGGCAGAACCCGCCGTGCTGCTCGGCGATCCGCCGGCGCCGGTGCAAGTCGTC
GAACTCGCCAAACCGCTGCCGCTACCCGGTCAGTTGAAGCCATTGGCGCGCGGCAAACCCACGCCCGAGG
CGAAGGACCCGGCCGTGCGCGTCAATCAGGCCAATGCCGCCGCACGGGTCCAGCCGGTACGCAACGGCTT
TATCAACGCCGTGCAGGTCTATCCATTCACCAGCGGCGCGCTCTATCAGGTCTACGCGGCGCCTGGCCAA
ATCACCGACGTGGCGCTCCAGGCCGGCGAGCAGCTGACCGGCTCCGGGCCCGTCGCTGCCGGCGACACCG
TGCGCTGGATCATCGGCGACACCGAGAGCGAAACCGGCGCCTCCAAGAAGGTCCACATCCTGATCAAGCC
GACCCGTCCCGATCTCGTCACAAACCTCGTCATCAACACCGATCGGCGGACCTATTTCCTTGAACTGCGT
TCGACCGAGAAGACCTACATGGCCTCGGTGTCCTGGCAGTATCCCGAAGACCAGCTCATTGCGCTGCGGC
GCCACAATGCAGCCGCCTTGACCGCGGCGCCGATCGATGAGGGCATCGAGGTTTCCAAACTGCGCTTCCG
TTATGCCATCACCGGCGACAATCCGCCCTGGCGTCCATTGTCCGCCTTCGATGACGGCTCAAAAGTCTAT
ATCGAAATGCCGCGCGGAATCGCCCAGGGCGAAGCACCGCCGTTGTTTGTAATCGGTCCGGAAGGCGACG
GCCAACTGGTCAATTATCGGGTCCGGCAAAACTATTATATCGTCGATCGGTTGTTCGGCGCCGCCGAGCT
GCGGCTTGGTGGCGACCACCAGCAGACGGTCCGTATCTCCCGCACCGACGGGAGGCTTTGA
 Primer design