SecReT4
Protein ID: 39937177
T4SS name [ID]Trb [334]
Gene symboltrbF2
Locus tagRPA4117
StrainRhodopseudomonas palustris CGA009
Repliconchromosome [GenBank: NC_005296] [Browse all T4SS(s) in this replicon]
Location [Strand]4660813..4661496 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ6N2D3
KEGG IDrpa:RPA4117
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.8e-60, Aligned region: 21..224
Protein Sequence: 227 a.a.     [Download]
>gi|39937177|ref|NP_949453.1| conjugal transfer protein TrbF [Rhodopseudomonas palustris CGA009]
MFRRSSVRYGRTPQAVTPYQKAAQVWDERIGSARVQARNWRLMAFGSLMLSVGLAGSLVWQSLRGSVTPW
VVQVDRLGQAQAVAPAAIDYQPSEAQIAYHLARFIEDIRGLPVDPVVLRQQWLRAYDFTTDRGAAALNDF
ARTNDPFANLGKMQISVEVSSVIRASPNSFRVAWIQRAYENGSLATTERWTAILTVVVQPPHDADRLRKN
PLGVYVNAISWSKELGQ
 
Nucleotide Sequence: 684 bp     [Download]
>gi|39933080|ref|NC_005296.1|:c4661496-4660813 Rhodopseudomonas palustris CGA009 chromosome, complete genome
ATGTTTCGAAGATCATCGGTCCGCTACGGTCGCACGCCGCAGGCTGTGACGCCGTATCAGAAGGCGGCGC
AAGTCTGGGACGAACGCATCGGTTCGGCCCGGGTCCAGGCCAGGAACTGGCGCCTGATGGCGTTCGGCTC
GCTGATGCTGTCGGTGGGTCTGGCGGGCAGTCTGGTCTGGCAATCCTTGCGCGGCAGCGTCACGCCCTGG
GTGGTGCAGGTCGATCGCCTCGGTCAGGCGCAGGCGGTGGCACCCGCGGCCATCGACTATCAGCCGTCTG
AGGCGCAGATCGCCTATCACCTCGCGCGGTTCATCGAGGATATCAGGGGACTACCGGTCGATCCGGTCGT
GCTGCGCCAACAATGGCTGCGCGCCTACGATTTCACCACGGATCGCGGCGCTGCCGCGCTCAACGATTTC
GCCCGCACCAATGATCCGTTCGCCAATCTCGGCAAGATGCAGATCTCGGTCGAGGTCTCCAGCGTCATCC
GCGCTTCGCCGAATAGTTTCCGCGTCGCCTGGATCCAGCGCGCCTACGAGAATGGCTCGCTCGCCACCAC
CGAACGCTGGACCGCGATTCTGACCGTCGTCGTTCAACCGCCGCACGACGCCGATCGTCTGCGCAAGAAC
CCACTCGGAGTTTACGTCAACGCCATCAGCTGGTCGAAGGAGCTTGGACAATGA
 Primer design